|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3ROF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3ROF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ROF) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ROF) |
Exons (0, 0)| (no "Exon" information available for 3ROF) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:158 aligned with PTPA_STAAU | P0C5D2 from UniProtKB/Swiss-Prot Length:154 Alignment length:158 1 | 5 15 25 35 45 55 65 75 85 95 105 115 125 135 145 PTPA_STAAU - -----MVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKE 153 SCOP domains d3rofa_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3rof A -4 AYFQGMVDVAFVCLGNICRSPMAEAIMRQRLKDRNIHDIKVHSRGTGSWNLGEPPHEGTQKILNKHNIPFDGMISELFEATDDFDYIVAMDQSNVDNIKSINPNLKGQLFKLLEFSNMEESDVPDPYYTNNFEGVYDMVLSSCDNLIDYIVKDANLKG 153 5 15 25 35 45 55 65 75 85 95 105 115 125 135 145
Chain B from PDB Type:PROTEIN Length:7
SCOP domains ------- SCOP domains
CATH domains ------- CATH domains
Pfam domains ------- Pfam domains
SAPs(SNPs) ------- SAPs(SNPs)
PROSITE ------- PROSITE
Transcript ------- Transcript
3rof B 49 HHHHHGS 55
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3ROF) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3ROF) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PTPA_STAAU | P0C5D2)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|