Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  DNA-BINDING PROTEIN HU FROM BACILLUS ANTHRACIS
 
Authors :  J. Osipiuk, M. Makowska-Grzyska, J. Hasseman, W. F. Anderson, A. Joach Center For Structural Genomics Of Infectious Diseases (Csgi
Date :  11 Apr 11  (Deposition) - 20 Apr 11  (Release) - 20 Apr 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.48
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Protein Hu, Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Osipiuk, M. Makowska-Grzyska, J. Hasseman, W. F. Anderson, A. Joachimiak
Dna-Binding Protein Hu From Bacillus Anthracis.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - DNA-BINDING PROTEIN HU
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: BAS3574
    Organism Scientific: BACILLUS ANTHRACIS
    Organism Taxid: 260799
    Strain: STERNE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3RHI)

(-) Sites  (0, 0)

(no "Site" information available for 3RHI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3RHI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3RHI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3RHI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3RHI)

(-) Exons   (0, 0)

(no "Exon" information available for 3RHI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:87
 aligned with Q81WV7_BACAN | Q81WV7 from UniProtKB/TrEMBL  Length:90

    Alignment length:87
                                    13        23        33        43        53        63        73        83       
          Q81WV7_BACAN    4 TELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTGRNPQTGEEMQIAASKVPAFKAGKELKEAVK 90
               SCOP domains d3rhia_ A: automated matches                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...eee...eeeeeeee..eeee......eeee..eeeeeeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  3rhi A  4 TELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTGRNPQTGEEMQIAASKVPAFKAGKELKEAVK 90
                                    13        23        33        43        53        63        73        83       


Chain B from PDB  Type:PROTEIN  Length:89
 aligned with Q81WV7_BACAN | Q81WV7 from UniProtKB/TrEMBL  Length:90

    Alignment length:92
                              1                                                                                         
                              |      8        18        28        38        48        58        68        78        88  
          Q81WV7_BACAN    - --MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTGRNPQTGEEMQIAASKVPAFKAGKELKEAVK 90
               SCOP domains d3rhib_ B: automated matches                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eehhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...eee...eeeeeeee.....---..........eeeeeeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                  3rhi B -1 NAMNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTG---QTGEEMQIAASKVPAFKAGKELKEAVK 90
                                     8        18        28        38        48        58 |   |  68        78        88  
                                                                                        60  64                          


Chain C from PDB  Type:PROTEIN  Length:90
 aligned with Q81WV7_BACAN | Q81WV7 from UniProtKB/TrEMBL  Length:90

    Alignment length:90
                                    10        20        30        40        50        60        70        80        90
          Q81WV7_BACAN    1 MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTGRNPQTGEEMQIAASKVPAFKAGKELKEAVK 90
               SCOP domains d3rhic_ C: automated matches                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...eee...eeeeeeee..eeee......eeee..eeeeeeeehhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                  3rhi C  1 MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTGRNPQTGEEMQIAASKVPAFKAGKELKEAVK 90
                                    10        20        30        40        50        60        70        80        90


Chain D from PDB  Type:PROTEIN  Length:82
 aligned with Q81WV7_BACAN | Q81WV7 from UniProtKB/TrEMBL  Length:90

    Alignment length:90
                                    10        20        30        40        50        60        70        80        90
          Q81WV7_BACAN    1 MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTGRNPQTGEEMQIAASKVPAFKAGKELKEAVK 90
               SCOP domains d3rhid_ D: automated matches                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) Bac_DNA_binding-3rhiD01 D:1-90                                                             Pfam domains (1)
           Pfam domains (2) Bac_DNA_binding-3rhiD02 D:1-90                                                             Pfam domains (2)
           Pfam domains (3) Bac_DNA_binding-3rhiD03 D:1-90                                                             Pfam domains (3)
           Pfam domains (4) Bac_DNA_binding-3rhiD04 D:1-90                                                             Pfam domains (4)
         Sec.struct. author .hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...eee...eeeeeeee....--------......eeeeeeeehhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                  3rhi D  1 MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAART--------EMQIAASKVPAFKAGKELKEAVK 90
                                    10        20        30        40        50        |-       |70        80        90
                                                                                     59       68
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3RHI)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: no clan defined [family: Bac_DNA_binding] (8)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q81WV7_BACAN | Q81WV7)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0030261    chromosome condensation    The progressive compaction of dispersed interphase chromatin into threadlike chromosomes prior to mitotic or meiotic nuclear division, or during apoptosis, in eukaryotic cells.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3rhi)
 
  Sites
(no "Sites" information available for 3rhi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3rhi)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3rhi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81WV7_BACAN | Q81WV7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81WV7_BACAN | Q81WV7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3RHI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3RHI)