Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHOGLYCERATE MUTASE FROM BACILLUS ANTHRACIS STR. STERNE
 
Authors :  C. Chang, G. Chhor, S. Clancy, A. Joachimiak, Midwest Center For Str Genomics (Mcsg)
Date :  22 Mar 11  (Deposition) - 20 Apr 11  (Release) - 20 Apr 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.84
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Psi-Biology, Midwest Center For Structural Genomics, Mcsg, Phosphoglycerate Mutase, Catalyzes The Internal Transfer Of A Phosphate Group From C-3 To C-2 Which Results In The Conversion Of 3-Phosphoglycerate (3Pg) To 2-Phosphoglycerate (2Pg), Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Chang, G. Chhor, S. Clancy, A. Joachimiak
Crystal Structure Of Phosphoglycerate Mutase From Bacillus Anthracis Str. Sterne
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHOSPHOGLYCERATE MUTASE, PUTATIVE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)MAGIC
    Expression System Taxid: 469008
    Expression System Vector Type: PMCSG7
    Gene: BAS3287, BA_3545, GBAA3545, GBAA_3545
    Organism Common: ANTHRAX,ANTHRAX BACTERIUM
    Organism Scientific: BACILLUS ANTHRACIS
    Organism Taxid: 260799
    Strain: STERNE
    Synonym: PUTATIVE PHOSPHOGLYCERATE MUTASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric Unit (2, 10)
No.NameCountTypeFull Name
1EPE2Ligand/Ion4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
2MSE8Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (2, 5)
No.NameCountTypeFull Name
1EPE1Ligand/Ion4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
2MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
1EPE1Ligand/Ion4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
2MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:17 , HIS A:18 , ASN A:24 , GLN A:30 , ARG A:67 , GLU A:94 , TRP A:109 , HIS A:179 , GLY A:180 , LEU A:181 , HOH A:235BINDING SITE FOR RESIDUE EPE A 301
2AC2SOFTWAREARG B:17 , HIS B:18 , ASN B:24 , GLN B:30 , ARG B:67 , GLU B:94 , TRP B:109 , HIS B:179 , GLY B:180 , LEU B:181 , HOH B:292 , HOH B:317BINDING SITE FOR RESIDUE EPE B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3R7A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3R7A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3R7A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3R7A)

(-) Exons   (0, 0)

(no "Exon" information available for 3R7A)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:227
 aligned with Q81YJ8_BACAN | Q81YJ8 from UniProtKB/TrEMBL  Length:234

    Alignment length:227
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       
         Q81YJ8_BACAN     4 RETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNMWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGIYTVESVGDMSYVAKGKE 230
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeee...hhhhhh...........hhhhhhhhhhhhhhh....eeeeee..hhhhhhhhhhhhhhh......eee.hhhh...hhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhh........eeeeeee..eeee.....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r7a A   4 RETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFmNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNmWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEmLDSSKTKLGVENASVTKIVYQDGIYTVESVGDmSYVAKGKE 230
                                    13        23        33        43        53    |   63        73        83        93       103    |  113       123       133       143       153       163       173       183     | 193       203       213       223       
                                                                                 58-MSE                                           108-MSE                                                                          189-MSE                          222-MSE    


Chain B from PDB  Type:PROTEIN  Length:228
 aligned with Q81YJ8_BACAN | Q81YJ8 from UniProtKB/TrEMBL  Length:234

    Alignment length:228
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224        
         Q81YJ8_BACAN     5 ETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNMWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGIYTVESVGDMSYVAKGKESV 232
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -------His_Phos_1-3r7aB01 B:12-186                                                                                                                                                    ---------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------His_Phos_1-3r7aB02 B:12-186                                                                                                                                                    ---------------------------------------------- Pfam domains (2)
         Sec.struct. author hhhhh.eeeeeee...hhhhhh...........hhhhhhhhhhhhhhh....eeeeee..hhhhhhhhhhhhhhh......eee.hhhh...hhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhh........eeeeeee..eeee.....hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3r7a B   5 ETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFmNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNmWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEmLDSSKTKLGVENASVTKIVYQDGIYTVESVGDmSYVAKGKESV 232
                                    14        24        34        44        54   |    64        74        84        94       104   |   114       124       134       144       154       164       174       184    |  194       204       214       224        
                                                                                58-MSE                                           108-MSE                                                                          189-MSE                          222-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3R7A)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3R7A)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: PGM (50)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q81YJ8_BACAN | Q81YJ8)
molecular function
    GO:0004619    phosphoglycerate mutase activity    Catalysis of the reaction: 2-phospho-D-glycerate = 3-phospho-D-glycerate.
biological process
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EPE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3r7a)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3r7a
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81YJ8_BACAN | Q81YJ8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81YJ8_BACAN | Q81YJ8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3R7A)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3R7A)