|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3R2K) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3R2K) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3R2K) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3R2K) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:154 aligned with BFR_PSEAE | Q9HWF9 from UniProtKB/Swiss-Prot Length:154 Alignment length:154 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 BFR_PSEAE 1 MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI 154 SCOP domains d3r2ka_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------Ferritin-3r2kA01 A:8-144 ---------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) FERRITIN_LIKE PDB: A:1-145 UniProt: 1-145 --------- PROSITE (1) PROSITE (2) BACTERIOFERRITIN --------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3r2k A 1 MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI 154 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3R2K) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A (BFR_PSEAE | Q9HWF9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|