Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE UNCHARACTERIZED PROTEIN AND POSSIBLE MOLYBDENUM COFACTOR PROTEIN FROM MYCOBACTERIUM SMEGMATIS
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  23 Feb 11  (Deposition) - 09 Mar 11  (Release) - 22 Apr 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Seattle Structural Genomics Center For Infectious Disease, Ssgcid, Putative Uncharacterized Protein, Lysine-Decarboxylase Like Protein, Molybdenum Cofactor Protein Like Protein, Moco, Possibly Misannotated Homologs, Ortholog, Mycobacterium, Tuberculosis, Unknown Ligand, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Baugh, I. Phan, D. W. Begley, M. C. Clifton, B. Armour, D. M. Dranow, B. M. Taylor, M. M. Muruthi, J. Abendroth, J. W. Fairman, D. Fox, S. H. Dieterich, B. L. Staker, A. S. Gardberg, R. Choi, S. N. Hewitt, A. J. Napuli, J. Myers, L. K. Barrett, Y. Zhang, M. Ferrell, E. Mundt, K. Thompkins, N. Tran, S. Lyons-Abbott, A. Abramov, A. Sekar, D. Serbzhinskiy, D. Lorimer, G. W. Buchko, R. Stacy, L. J. Stewart, T. E. Edwards, W. C. Van Voorhis, P. J. Myler
Increasing The Structural Coverage Of Tuberculosis Drug Targets.
Tuberculosis (Edinb) V. 95 142 2015
PubMed-ID: 25613812  |  Reference-DOI: 10.1016/J.TUBE.2014.12.003

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PAVA0421
    Gene: MSMEG_5087
    Organism Scientific: MYCOBACTERIUM SMEGMATIS STR. MC2 155
    Organism Taxid: 246196
    Strain: ATCC 700084 / MC(2)155

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1UNL2Ligand/IonUNKNOWN LIGAND

(-) Sites  (0, 0)

(no "Site" information available for 3QUA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QUA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3QUA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QUA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3QUA)

(-) Exons   (0, 0)

(no "Exon" information available for 3QUA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:179
 aligned with A0R2E9_MYCS2 | A0R2E9 from UniProtKB/TrEMBL  Length:194

    Alignment length:179
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185         
         A0R2E9_MYCS2    16 RQWAVCVYCASGPTHPELLELAAEVGSSIAARGWTLVSGGGNVSAMGAVAQAARAKGGHTVGVIPKALVHRELADVDAAELIVTDTMRERKREMEHRSDAFIALPGGIGTLEEFFEAWTAGYLGMHDKPLILLDPFGHYDGLLTWLRGLVPTGYVSQRAMDSLVVVDNVEAALEACAPE 194
               SCOP domains d3quaa_ A: automated matches                                                                                                                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee......hhhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhhhhh...eeeeee.hhh..........eeeee.hhhhhhhhhhhhh.eeee...hhhhhhhhhhhhhhhhh......eeee.....hhhhhhhhhhh......hhhhhhh.eee.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qua A  16 RQWAVCVYCASGPTHPELLELAAEVGSSIAARGWTLVSGGGNVSAMGAVAQAARAKGGHTVGVIPKALVHRELADVDAAELIVTDTMRERKREMEHRSDAFIALPGGIGTLEEFFEAWTAGYLGMHDKPLILLDPFGHYDGLLTWLRGLVPTGYVSQRAMDSLVVVDNVEAALEACAPE 194
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185         


Chain B from PDB  Type:PROTEIN  Length:179
 aligned with A0R2E9_MYCS2 | A0R2E9 from UniProtKB/TrEMBL  Length:194

    Alignment length:179
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185         
         A0R2E9_MYCS2    16 RQWAVCVYCASGPTHPELLELAAEVGSSIAARGWTLVSGGGNVSAMGAVAQAARAKGGHTVGVIPKALVHRELADVDAAELIVTDTMRERKREMEHRSDAFIALPGGIGTLEEFFEAWTAGYLGMHDKPLILLDPFGHYDGLLTWLRGLVPTGYVSQRAMDSLVVVDNVEAALEACAPE 194
               SCOP domains d3quab_ B: automated matches                                                                                                                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------------------------------Lysine_decarbox-3quaB01 B:61-191                                                                                                   --- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------Lysine_decarbox-3quaB02 B:61-191                                                                                                   --- Pfam domains (2)
         Sec.struct. author ...eeeee......hhhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhhhhh...eeeeee.hhh..........eeeee.hhhhhhhhhhhh..eeee...hhhhhhhhhhhhhhhhh......eeee.....hhhhhhhhhhh......hhhhhhhheee.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qua B  16 RQWAVCVYCASGPTHPELLELAAEVGSSIAARGWTLVSGGGNVSAMGAVAQAARAKGGHTVGVIPKALVHRELADVDAAELIVTDTMRERKREMEHRSDAFIALPGGIGTLEEFFEAWTAGYLGMHDKPLILLDPFGHYDGLLTWLRGLVPTGYVSQRAMDSLVVVDNVEAALEACAPE 194
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QUA)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: DprA (10)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (A0R2E9_MYCS2 | A0R2E9)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016799    hydrolase activity, hydrolyzing N-glycosyl compounds    Catalysis of the hydrolysis of any N-glycosyl bond.
biological process
    GO:0009691    cytokinin biosynthetic process    The chemical reactions and pathways resulting in the formation of cytokinins, a class of adenine-derived compounds that can function in plants as growth regulators.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    UNL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3qua)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qua)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qua
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0R2E9_MYCS2 | A0R2E9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0R2E9_MYCS2 | A0R2E9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3QUA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3QUA)