|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3POA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3POA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3POA) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3POA) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:96 aligned with FHAA_MYCTU | P71590 from UniProtKB/Swiss-Prot Length:527 Alignment length:96 527 443 453 463 473 483 493 503 513 523 | FHAA_MYCTU 434 TSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMH-- - SCOP domains d3poaa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---------------------FHA_DOMAIN PDB: A:25-74 UniProt: 455-504 ------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3poa A 4 TSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMHPL 99 13 23 33 43 53 63 73 83 93
Chain B from PDB Type:PROTEIN Length:7
SCOP domains ------- SCOP domains
CATH domains ------- CATH domains
Pfam domains ------- Pfam domains
SAPs(SNPs) ------- SAPs(SNPs)
PROSITE ------- PROSITE
Transcript ------- Transcript
3poa B 2 TAPtEKI 8
|
5-TPO
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3POA) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3POA) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (FHAA_MYCTU | P71590)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|