|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric Unit (3, 3) Biological Unit 1 (3, 12) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3PLX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3PLX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3PLX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3PLX) |
Exons (0, 0)| (no "Exon" information available for 3PLX) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:25 aligned with PAND_CAMJE | Q9PIK3 from UniProtKB/Swiss-Prot Length:126 Alignment length:25 1 | 9 19 PAND_CAMJE - -MNITLLKSKIHRASVTEARLDYIG 24 SCOP domains ------------------------- SCOP domains CATH domains ------------------------- CATH domains Pfam domains ------------------------- Pfam domains SAPs(SNPs) ------------------------- SAPs(SNPs) PROSITE ------------------------- PROSITE Transcript ------------------------- Transcript 3plx A 0 AMNITLLKSKIHRASVTEARLDYIG 24 9 19 Chain B from PDB Type:PROTEIN Length:101 aligned with PAND_CAMJE | Q9PIK3 from UniProtKB/Swiss-Prot Length:126 Alignment length:101 34 44 54 64 74 84 94 104 114 124 PAND_CAMJE 25 SISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI 125 SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -Asp_decarbox-3plxB01 B:26-115 ---------- Pfam domains (1) Pfam domains (2) -Asp_decarbox-3plxB02 B:26-115 ---------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 3plx B 25 xISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITNYEKHGAI 125 | 34 44 54 64 74 84 94 104 114 124 25-PYR
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3PLX) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3PLX) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (PAND_CAMJE | Q9PIK3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|