|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3PIS) |
Sites (0, 0)| (no "Site" information available for 3PIS) |
SS Bonds (4, 4)
Asymmetric Unit
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3PIS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3PIS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3PIS) |
Exons (0, 0)| (no "Exon" information available for 3PIS) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:39 aligned with A1X1V8_CARRO | A1X1V8 from UniProtKB/TrEMBL Length:109 Alignment length:39 34 44 54 A1X1V8_CARRO 25 PCPHTYKPVCGANGEVYDNECFLNKAGIEPAESWETCRG 63 SCOP domains --------------------------------------- SCOP domains CATH domains --------------------------------------- CATH domains Pfam domains --------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------- SAPs(SNPs) PROSITE --------------------------------------- PROSITE Transcript --------------------------------------- Transcript 3pis A 1 SCPHTYKPVCGANGEVYDNECFLNKAGIEPAESWETCRG 39 10 20 30 Chain D from PDB Type:PROTEIN Length:39 aligned with A1X1V8_CARRO | A1X1V8 from UniProtKB/TrEMBL Length:109 Alignment length:39 35 45 55 A1X1V8_CARRO 26 CPHTYKPVCGANGEVYDNECFLNKAGIEPAESWETCRGH 64 SCOP domains --------------------------------------- SCOP domains CATH domains --------------------------------------- CATH domains Pfam domains (1) Kazal_1-3pisD01 D:2-40 Pfam domains (1) Pfam domains (2) Kazal_1-3pisD02 D:2-40 Pfam domains (2) SAPs(SNPs) --------------------------------------- SAPs(SNPs) PROSITE --------------------------------------- PROSITE Transcript --------------------------------------- Transcript 3pis D 2 CPHTYKPVCGANGEVYDNECFLNKAGIEPAESWETCRGH 40 11 21 31
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3PIS) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3PIS) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,D (A1X1V8_CARRO | A1X1V8)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|