3PC6 - JenaLib

Title :   X-RAY CRYSTAL STRUCTURE OF THE SECOND XRCC1 BRCT DOMAIN.

Authors :   M. J. Cuneo, J. M. Krahn, R. E. London

Date :   21 Oct 10 (Deposition) - 15 Jun 11 (Release) - 02 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Dna Repair, Brct Domain, Protein:Protein Interactions, Dna Ligase Iii-Alpha Brct2 Domain, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Cuneo, S. A. Gabel, J. M. Krahn, M. A. Ricker, R. E. London
The Structural Basis For Partitioning Of The Xrcc1/Dna Ligase Iii-{Alpha} Brct-Mediated Dimer Complexes.
Nucleic Acids Res. V. 39 7816 2011
PubMed-ID: 21652643 | Reference-DOI: 10.1093/NAR/GKR419

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:99
 aligned with XRCC1_MOUSE | Q60596 from UniProtKB/Swiss-Prot  Length:631

    Alignment length:99
                                                                                                                         631   
                                   545       555       565       575       585       595       605       615       625     |   
          XRCC1_MOUSE   536 ELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA---   -
               SCOP domains d3pc6a_ A: automated matches                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeee.....hhhhhhhhhhhhh..ee.........eeee....hhhhhhhhh.....eeehhhhhhhhhhhh...hhhhhh...hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE BRCT  PDB: A:536-627 UniProt: 536-627                                                       ------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 3pc6 A 536 ELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQAHHH 634
                                   545       555       565       575       585       595       605       615       625

Chain B from PDB  Type:PROTEIN  Length:103
 aligned with XRCC1_MOUSE | Q60596 from UniProtKB/Swiss-Prot  Length:631

    Alignment length:103
                                                                                                                          631      
                                   544       554       564       574       584       594       604       614       624      |  -   
          XRCC1_MOUSE   535 PELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA------   -
               SCOP domains d3pc6b_ B: automated matches                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -BRCT-3pc6B01 B:536-614                                                         ----------------------- Pfam domains (1)
           Pfam domains (2) -BRCT-3pc6B02 B:536-614                                                         ----------------------- Pfam domains (2)
         Sec.struct. author ..........eeeee.....hhhhhhhhhhhhh..ee.........eeee......hhhhhhhhh...eee.hhhhhhhhhhh...hhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -BRCT  PDB: B:536-627 UniProt: 536-627                                                       ---------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 3pc6 B 535 PELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMNERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQAHHHHHH 637
                                   544       554       564       574       584       594       604       614       624       634

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (XRCC1_MOUSE | Q60596)

molecular function
	GO:0003684	damaged DNA binding	Interacting selectively and non-covalently with damaged DNA.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006284	base-excision repair	In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0021766	hippocampus development	The progression of the hippocampus over time from its initial formation until its mature state.
	GO:0000012	single strand break repair	The repair of single strand breaks in DNA. Repair of such breaks is mediated by the same enzyme systems as are used in base excision repair.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3pc6)

	Sites
(no "Sites" information available for 3pc6)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3pc6)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3pc6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	XRCC1_MOUSE \| Q60596
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description