Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  IMPROVED NADPH-DEPENDENT BLUE FLUORESCENT PROTEIN
 
Authors :  T. H. Kao, Y. Chen, C. H. Pai, A. H. J. Wang
Date :  30 Sep 10  (Deposition) - 20 Jul 11  (Release) - 20 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  A,B  (1x)
Biol. Unit 3:  C,D  (1x)
Keywords :  Rossmann-Fold, Blue Fluorescent Protein, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. H. Kao, Y. Chen, C. H. Pai, M. C. Chang, A. H. J. Wang
Structure Of A Nadph-Dependent Blue Fluorescent Protein Revealed The Unique Role Of Gly176 On The Fluorescence Enhancement.
J. Struct. Biol. V. 174 485 2011
PubMed-ID: 21397029  |  Reference-DOI: 10.1016/J.JSB.2011.02.010

(-) Compounds

Molecule 1 - PUTATIVE BLUE FLUORESCENT PROTEIN
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificVIBRIO VULNIFICUS
    Organism Taxid672
    SynonymBFPVVD8

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)ABCD
Biological Unit 2 (1x)AB  
Biological Unit 3 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1NDP4Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1NDP4Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (0, 0)

(no "Site" information available for 3P19)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3P19)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gly C:203 -Gly C:204

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3P19)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3P19)

(-) Exons   (0, 0)

(no "Exon" information available for 3P19)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:239
 aligned with Q9F172_VIBVL | Q9F172 from UniProtKB/TrEMBL  Length:239

    Alignment length:239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         
         Q9F172_VIBVL     1 MKKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLEALNLPNTLCAQVDVTDKNTFDAAITRAEKIYGPADVLVNNAGVMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNSGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVTTIAPGAVETELLSHTTSQQIKDGYDAWKVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP 239
               SCOP domains d3p19a_ A: automated matches                                                                                                                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhh.....eeeee....hhhhhhhhhhhhhhhhh.eeeeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh...eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p19 A   1 MKKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLSHTTSQQIKDGYDAWRVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP 239
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230         

Chain B from PDB  Type:PROTEIN  Length:218
 aligned with Q9F172_VIBVL | Q9F172 from UniProtKB/TrEMBL  Length:239

    Alignment length:236
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231      
         Q9F172_VIBVL     2 KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLEALNLPNTLCAQVDVTDKNTFDAAITRAEKIYGPADVLVNNAGVMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNSGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVTTIAPGAVETELLSHTTSQQIKDGYDAWKVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQ 237
               SCOP domains d3p19b_ B: automated matches                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhh.eeeeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee..ee.....------------------...eehhhhhhhhhhhhhh...eeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p19 B   2 KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLS------------------GGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQ 237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181  |      -         - |     211       221       231      
                                                                                                                                                                                                                184                203                                  

Chain C from PDB  Type:PROTEIN  Length:218
 aligned with Q9F172_VIBVL | Q9F172 from UniProtKB/TrEMBL  Length:239

    Alignment length:236
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231      
         Q9F172_VIBVL     2 KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLEALNLPNTLCAQVDVTDKNTFDAAITRAEKIYGPADVLVNNAGVMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNSGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVTTIAPGAVETELLSHTTSQQIKDGYDAWKVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQ 237
               SCOP domains d3p19c_ C: automated matches                                                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh...eeeee.hhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhh.eeeeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.........------------------....hhhhhhhhhhhhhh....eeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p19 C   2 KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLS------------------GGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQ 237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181  |      -         - |     211       221       231      
                                                                                                                                                                                                                184                203                                  

Chain D from PDB  Type:PROTEIN  Length:238
 aligned with Q9F172_VIBVL | Q9F172 from UniProtKB/TrEMBL  Length:239

    Alignment length:238
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231        
         Q9F172_VIBVL     2 KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLEALNLPNTLCAQVDVTDKNTFDAAITRAEKIYGPADVLVNNAGVMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNSGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVTTIAPGAVETELLSHTTSQQIKDGYDAWKVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP 239
               SCOP domains d3p19d_ D: automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee...hhhhhhhhhhhhhh...eeeee.hhhhhhh.....eeeee....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee.....hhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh...eeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p19 D   2 KKLVVITGASSGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTAITRAEKIYGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVAASNVRVMTIAPSAVKTELLSHTTSQQIKDGYDAWRVDMGGVLAADDVARAVLFAYQQPQNVCIREIALAPTKQQP 239
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3P19)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3P19)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q9F172_VIBVL | Q9F172)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3p19)
 
  Cis Peptide Bonds
    Gly C:203 - Gly C:204   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3p19
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9F172_VIBVL | Q9F172
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9F172_VIBVL | Q9F172
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3P19)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3P19)