Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BETA-LACTAMASE/D-ALANINE CARBOXYPEPTIDASE FROM YERSINIA PESTIS
 
Authors :  Y. Kim, M. Zhou, M. Gu, W. F. Anderson, A. Joachimiak, Center For Struc Genomics Of Infectious Diseases (Csgid)
Date :  24 Sep 10  (Deposition) - 20 Oct 10  (Release) - 20 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.91
Chains :  Asym./Biol. Unit :  A
Keywords :  Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Alpha-Beta Sandwich, Cytosol, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Kim, M. Zhou, M. Gu, W. F. Anderson, A. Joachimiak, Center For Structural Genomics Of Infectious Diseases (Csgid)
Crystal Structure Of Beta-Lactamase/D-Alanine Carboxypeptidase From Yersinia Pestis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - BETA-LACTAMASE/D-ALANINE CARBOXYPEPTIDASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21 MAGIC
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 39 -386
    GeneAMPH, Y2964, YPO1224, YP_0915
    Organism ScientificYERSINIA PESTIS
    Organism Taxid214092
    StrainCO92
    SynonymPUTATIVE PENICILLIN-BINDING PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 13)

Asymmetric/Biological Unit (1, 13)
No.NameCountTypeFull Name
1MSE13Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3OZH)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:240 -A:252

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Trp A:169 -Pro A:170

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3OZH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3OZH)

(-) Exons   (0, 0)

(no "Exon" information available for 3OZH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:351
 aligned with Q7CHA2_YERPE | Q7CHA2 from UniProtKB/TrEMBL  Length:388

    Alignment length:351
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385 
         Q7CHA2_YERPE    36 DTKLLTSQIVDQYAEHIFYNSGAVGMALVVIDNNQVVNRSFGETQPGNNIRPRPDSLIRIASITKLMTSEIMVKLADDGIVKLTDPLKKYAPKGVNVPSYSAKQPIRLLHLASHTSGLPREQPGGPQKRPVFTWPTKDNRWQWLKLAKVTVPPGVKAAYSNLAYDLLADALSRAAGKPYAHLLRDKITAPLGMKNTTLTPTAEQCKRLMIGVGSSRCGNTVAAAGSGGIYSTPEDMQHWMQQFLASDNSAPKRSAKREQALYFQRGDLVSLKGMDVAGQADALGLGWVYMAPKADLPGIMQKTGGGGGFITYMAMVPEKNIGVFVVVTRSQLTKFSNMSDGVNQLVAELVK 386
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----Beta-lactamase-3ozhA01 A:41-380                                                                                                                                                                                                                                                                                                                     ------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh...eeeeeeee..eeeeeeee...............ee...hhhhhhhhhhhhhhhh.......hhhhhh...............hhhhhhh......................hhhhhhhhhh..........eee.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh........hhhhhh.............hhhhh.....eehhhhhhhhhhh...........hhhhhh.eeee.hhh.eee.........eee...eee........eeeeeeee..eeeeeeeehhh.eeeeeeee.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ozh A  36 SNALLTSQIVDQYAEHIFYNSGAVGmALVVIDNNQVVNRSFGETQPGNNIRPRPDSLIRIASITKLmTSEImVKLADDGIVKLTDPLKKYAPKGVNVPSYSAKQPIRLLHLASHTSGLPREQPGGPQKRPVFTWPTKDNRWQWLKLAKVTVPPGVKAAYSNLAYDLLADALSRAAGKPYAHLLRDKITAPLGmKNTTLTPTAEQCKRLmIGVGSSRCGNTVAAAGSGGIYSTPEDmQHWmQQFLASDNSAPKRSAKREQALYFQRGDLVSLKGmDVAGQADALGLGWVYmAPKADLPGImQKTGGGGGFITYmAmVPEKNIGVFVVVTRSQLTKFSNmSDGVNQLVAELVK 386
                                    45        55     |  65        75        85        95      |105 |     115       125       135       145       155       165       175       185       195       205       215       225  |    235       245       255       265     | 275       285       295       305   |   315       325       335       345  | |  355       365       375       385 
                                                    61-MSE                                  102-MSE|                                                                                                                      228-MSE         244-MSE                    271-MSE                               309-MSE         325-MSE   335-MSE      348-MSE                  373-MSE         
                                                                                                 107-MSE                                                                                                                                                                 275-MSE                                                                    350-MSE                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3OZH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3OZH)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3OZH)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3ozh)
 
  Cis Peptide Bonds
    Trp A:169 - Pro A:170   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ozh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7CHA2_YERPE | Q7CHA2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7CHA2_YERPE | Q7CHA2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7CHA2_YERPE | Q7CHA23rju

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3OZH)