|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3OMF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3OMF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3OMF) |
PROSITE Motifs (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) |
Exons (0, 0)| (no "Exon" information available for 3OMF) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:111 aligned with HIT_ENTHI | C4LYI2 from UniProtKB/Swiss-Prot Length:113 Alignment length:111 12 22 32 42 52 62 72 82 92 102 112 HIT_ENTHI 3 DSCIFCKIAQKQIPSTIVYEDDEIFAFKDINPIAPIHILVIPKQHIASLNEITEENEAFIGKVLYKVSLIGKKECPEGYRVVNNIGEDAGQTVKHIHFHILGGKKLAWDKL 113 SCOP domains d3omfa_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---HIT_2 PDB: A:6-113 UniProt: 6-113 PROSITE (1) PROSITE (2) -----------------------------------------------------------------------------------HIT_1 PDB: A:86-10--------- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------- Transcript 3omf A 3 DSCIFCKIAQKQIPSTIVYEDDEIFAFKDINPIAPIHILVIPKQHIASLNEITEENEAFIGKVLYKVSLIGKKECPEGYRVVNNIGEDAGQTVKHIHFHILGGKKLAWDKL 113 12 22 32 42 52 62 72 82 92 102 112
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3OMF) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3OMF) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (HIT_ENTHI | C4LYI2)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|