|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3O9O) |
Sites (0, 0)| (no "Site" information available for 3O9O) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3O9O) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3O9O) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3O9O) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3O9O) |
Exons (0, 0)| (no "Exon" information available for 3O9O) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:92 aligned with Q8E5F8_STRA3 | Q8E5F8 from UniProtKB/TrEMBL Length:96 Alignment length:92 13 23 33 43 53 63 73 83 93 Q8E5F8_STRA3 4 IKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQIS 95 SCOP domains d3o9oa_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 3o9o A 4 IKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQIS 95 13 23 33 43 53 63 73 83 93 Chain B from PDB Type:PROTEIN Length:96 aligned with Q8E5F8_STRA3 | Q8E5F8 from UniProtKB/TrEMBL Length:96 Alignment length:96 1 | 9 19 29 39 49 59 69 79 89 Q8E5F8_STRA3 - -MAQIKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQIS 95 SCOP domains d3o9ob_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains (1) ---WXG100-3o9oB01 B:3-88 ------- Pfam domains (1) Pfam domains (2) ---WXG100-3o9oB02 B:3-88 ------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3o9o B 0 SMAQIKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQIS 95 9 19 29 39 49 59 69 79 89
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3O9O) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3O9O)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|