3O6B - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:195
 aligned with DCN1_YEAST | Q12395 from UniProtKB/Swiss-Prot  Length:269

    Alignment length:195
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261     
           DCN1_YEAST    72 PKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ 266
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh.....hhhhhhhhhhhh.....hhhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeehhhhhhhhhhhh........hhhhhhhhhhhhhhh...eeehhhhhhhhhhhhhh.hhhhhhhhh......hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE DCUN1  PDB: - UniProt: 70-266                                                                                                                                                                       PROSITE
               Transcript 1 Exon 1.2  PDB: A:72-266 UniProt: 2-269 [INCOMPLETE]                                                                                                                                                 Transcript 1
                 3o6b A  72 PKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ 266
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261

Chain B from PDB  Type:PROTEIN  Length:70
 aligned with CDC53_YEAST | Q12018 from UniProtKB/Swiss-Prot  Length:815

    Alignment length:70
                                   755       765       775       785       795       805       815
          CDC53_YEAST   746 ERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhh.eehhhhhhhhhhh.......hhhhhhhhhhhhhhhh.eee.....eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------CULLIN_1  PDB: B:789-815    PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 3o6b B 746 ERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
                                   755       765       775       785       795       805       815

Chain C from PDB  Type:PROTEIN  Length:198
 aligned with DCN1_YEAST | Q12395 from UniProtKB/Swiss-Prot  Length:269

    Alignment length:198
                                    78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258        
           DCN1_YEAST    69 PVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ 266
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh.....hhhhhhhhhhhhh....hhhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eehhhhhhhhhhhh........hhhhhhhhhhhhhhh...eehhhhhhhhhhhhh....hhhhhh........hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -DCUN1  PDB: C:70-266 UniProt: 70-266                                                                                                                                                                  PROSITE
               Transcript 1 Exon 1.2  PDB: C:69-266 UniProt: 2-269 [INCOMPLETE]                                                                                                                                                    Transcript 1
                 3o6b C  69 SVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ 266
                                    78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258

Chain D from PDB  Type:PROTEIN  Length:68
 aligned with CDC53_YEAST | Q12018 from UniProtKB/Swiss-Prot  Length:815

    Alignment length:70
                                   755       765       775       785       795       805       815
          CDC53_YEAST   746 ERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh.eehhhhhhhhhh...--...hhhhhhhhhhhhhhhh.eee.....eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------CULLIN_1  PDB: D:789-815    PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 3o6b D 746 ERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSH--FNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
                                   755       765       775   |  |785       795       805       815
                                                           779  |                                 
                                                              782

Chain E from PDB  Type:PROTEIN  Length:195
 aligned with DCN1_YEAST | Q12395 from UniProtKB/Swiss-Prot  Length:269

    Alignment length:195
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260     
           DCN1_YEAST    71 YPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECL 265
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.....hhhhhhhhhhh......hhhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeehhhhhhhhhhhh........hhhhhhhhhhhhhhhh..eeehhhhhhhhhhhhhh.hhhhhhhhh......hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE DCUN1  PDB: - UniProt: 70-266                                                                                                                                                                       PROSITE
               Transcript 1 Exon 1.2  PDB: E:71-265 UniProt: 2-269 [INCOMPLETE]                                                                                                                                                 Transcript 1
                 3o6b E  71 YPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECL 265
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260

Chain F from PDB  Type:PROTEIN  Length:68
 aligned with CDC53_YEAST | Q12018 from UniProtKB/Swiss-Prot  Length:815

    Alignment length:71
                                   754       764       774       784       794       804       814 
          CDC53_YEAST   745 TERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
               SCOP domains ----------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhheeehhhhhhhhhh..---...hhhhhhhhhhhhhhh..eee.....eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------CULLIN_1  PDB: F:789-815    PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                 3o6b F 745 TERQIFLEACIVRIMKAKRNLPHTTLVNECIAQS---FNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
                                   754       764       774   |   784       794       804       814 
                                                           778 782

Chain G from PDB  Type:PROTEIN  Length:192
 aligned with DCN1_YEAST | Q12395 from UniProtKB/Swiss-Prot  Length:269

    Alignment length:192
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263  
           DCN1_YEAST    74 ELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECL 265
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhh.....hhhhhhhhhhh.......hhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eehhhhhhhhhhhh........hhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhh.hhhhhhhhh......hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE DCUN1  PDB: - UniProt: 70-266                                                                                                                                                                    PROSITE
               Transcript 1 Exon 1.2  PDB: G:74-265 UniProt: 2-269 [INCOMPLETE]                                                                                                                                              Transcript 1
                 3o6b G  74 ELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECL 265
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263

Chain H from PDB  Type:PROTEIN  Length:68
 aligned with CDC53_YEAST | Q12018 from UniProtKB/Swiss-Prot  Length:815

    Alignment length:68
                                   757       767       777       787       797       807        
          CDC53_YEAST   748 QIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh...eeehhhhhhhhhhhh......hhhhhhhhhhhhhhh..eee.....eeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------CULLIN_1  PDB: H:789-815    PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                 3o6b H 748 QIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
                                   757       767       777       787       797       807

Chain I from PDB  Type:PROTEIN  Length:157
 aligned with DCN1_YEAST | Q12395 from UniProtKB/Swiss-Prot  Length:269

    Alignment length:195
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264     
           DCN1_YEAST    75 LTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ 269
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----          --------       ----------------------------------  -Cullin_binding-3o6bI01 I:142-266                                                                                             --- Pfam domains (1)
           Pfam domains (2) -----          --------       ----------------------------------  -Cullin_binding-3o6bI02 I:142-266                                                                                             --- Pfam domains (2)
           Pfam domains (3) -----          --------       ----------------------------------  -Cullin_binding-3o6bI03 I:142-266                                                                                             --- Pfam domains (3)
           Pfam domains (4) -----          --------       ----------------------------------  -Cullin_binding-3o6bI04 I:142-266                                                                                             --- Pfam domains (4)
           Pfam domains (5) -----          --------       ----------------------------------  -Cullin_binding-3o6bI05 I:142-266                                                                                             --- Pfam domains (5)
         Sec.struct. author .....----------.hhhhhhh-------.hhhhhhhhhhhh........hhhhhhhhhhh..--hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eehhhhhhhhhhhh...------........hhhhhh...ee..hhhhhhhhhhh...-------------....hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE DCUN1  PDB: - UniProt: 70-266                                                                                                                                                                   --- PROSITE
               Transcript 1 Exon 1.2  PDB: I:75-269 (gaps) UniProt: 2-269 [INCOMPLETE]                                                                                                                                          Transcript 1
                 3o6b I  75 LTQVF----------IDSLVKFI-------EDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQG--TISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPE------PDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYP-------------AWPFIIDEFYECLQDQQ 269
                                |    -     |  94  |      -|      114       124       134   |  |144       154       164       174       184       194   |     -|      214       224       234    |    -       254       264     
                               79         90     97     105                              138  |                                                      198    205                               239           253                
                                                                                            141

Chain J from PDB  Type:PROTEIN  Length:61
 aligned with CDC53_YEAST | Q12018 from UniProtKB/Swiss-Prot  Length:815

    Alignment length:70
                                   755       765       775       785       795       805       815
          CDC53_YEAST   746 ERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
               SCOP domains ---------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------- CATH domains
           Pfam domains (1) Cullin_Nedd8-3o6   bJ01 J:746-810                                ----- Pfam domains (1)
           Pfam domains (2) Cullin_Nedd8-3o6   bJ02 J:746-810                                ----- Pfam domains (2)
           Pfam domains (3) Cullin_Nedd8-3o6   bJ03 J:746-810                                ----- Pfam domains (3)
           Pfam domains (4) Cullin_Nedd8-3o6   bJ04 J:746-810                                ----- Pfam domains (4)
           Pfam domains (5) Cullin_Nedd8-3o6   bJ05 J:746-810                                ----- Pfam domains (5)
         Sec.struct. author hhhhhhhhhhhhhhh.---.hhhhhhhhhhhhh.------..hhhhhhhhhhhhh.eee......eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------CULLIN_1  PDB: J:789-815    PROSITE
                 Transcript ---------------------------------------------------------------------- Transcript
                 3o6b J 746 ERQIFLEACIVRIMKA---LPHTTLVNECIAQSH------VSMVKRAIDSLIQKGYLQRGDDGESYAYLA 815
                                   755     | 765       775   |     -|      795       805       815
                                         761 765           779    786

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,C,E,G,I (DCN1_YEAST | Q12395)

molecular function
	GO:0097602	cullin family protein binding	Interacting selectively and non-covalently with any member of the cullin family, hydrophobic proteins that act as scaffolds for ubiquitin ligases (E3).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0043130	ubiquitin binding	Interacting selectively and non-covalently with ubiquitin, a protein that when covalently bound to other cellular proteins marks them for proteolytic degradation.
	GO:0031624	ubiquitin conjugating enzyme binding	Interacting selectively and non-covalently with a ubiquitin conjugating enzyme, any of the E2 proteins.
	GO:0032182	ubiquitin-like protein binding	Interacting selectively and non-covalently with a small conjugating protein such as ubiquitin or a ubiquitin-like protein.
biological process
	GO:0051443	positive regulation of ubiquitin-protein transferase activity	Any process that activates, maintains or increases the rate of ubiquitin transferase activity.
	GO:0045116	protein neddylation	Covalent attachment of the ubiquitin-like protein NEDD8 (RUB1) to another protein.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
	GO:0000151	ubiquitin ligase complex	A protein complex that includes a ubiquitin-protein ligase and enables ubiquitin protein ligase activity. The complex also contains other proteins that may confer substrate specificity on the complex.

Chain B,D,F,H,J (CDC53_YEAST | Q12018)

molecular function
	GO:0003688	DNA replication origin binding	Interacting selectively and non-covalently with the DNA replication origin, a unique DNA sequence of a replicon at which DNA replication is initiated and proceeds bidirectionally or unidirectionally.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0061630	ubiquitin protein ligase activity	Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
	GO:0000082	G1/S transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
	GO:0000086	G2/M transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
	GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, with ubiquitin-protein ligation catalyzed by an SCF (Skp1/Cul1/F-box protein) complex, and mediated by the proteasome.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
	GO:0006511	ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
	GO:0019005	SCF ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul1 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a Skp1 adaptor and an F-box protein. SCF complexes are involved in targeting proteins for degradation by the proteasome. The best characterized complexes are those from yeast and mammals (with core subunits named Cdc53/Cul1, Rbx1/Hrt1/Roc1).
	GO:0031461	cullin-RING ubiquitin ligase complex	Any ubiquitin ligase complex in which the catalytic core consists of a member of the cullin family and a RING domain protein; the core is associated with one or more additional proteins that confer substrate specificity.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 6)

Exons (1, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 10)

Gene Ontology (25, 27)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File