3NY7 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STAS DOMAIN OF YCHM BOUND TO ACP

Authors :   T. F. Moraes, R. Reithmeier, N. C. S. Strynadka

Date :   14 Jul 10 (Deposition) - 01 Dec 10 (Release) - 01 Dec 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.92

Chains :   Asym./Biol. Unit : A,B

Keywords :   Fatty Acid Biosynthesis(Fab), Bicarbonate Transport, Anion Transport, Membrane Protein, Stas Domain, Acyl Carrier Protein, Slc26, Ychm, 4'-Phosphopantetheine, Ser 36 Of Acp (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Babu, J. F. Greenblatt, A. Emili, N. C. Strynadka, R. A. Reithmeier, T. F. Moraes
Structure Of A Slc26 Anion Transporter Stas Domain In Complex With Acyl Carrier Protein: Implications For E. Coli Ychm In Fatty Acid Metabolism.
Structure V. 18 1450 2010
PubMed-ID: 21070944 | Reference-DOI: 10.1016/J.STR.2010.08.015

Molecule 1 - SULFATE TRANSPORTER
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 436-550
	Gene	:	YCHM
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Synonym	:	YCHM PROTEIN

Molecule 2 - ACYL CARRIER PROTEIN
	Chains	:	B
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Synonym	:	ACP

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 2)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	SXM	1	Ligand/Ion	3-{[2-({N-[(2S)-2-HYDROXY-3,3-DIMETHYL-4-(PHOSPHONOOXY)BUTANOYL]-BETA-ALANYL}AMINO)ETHYL]SULFANYL}-3-OXOPROPANOIC ACID

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:543 , ARG A:544 , MET A:547 , ASN B:26 , ASP B:32	BINDING SITE FOR RESIDUE GOL A 1
2	AC2	SOFTWARE	HOH A:16 , HOH A:49 , HOH A:231 , MET A:525 , ALA A:526 , GLY A:529 , ILE A:530 , GLN A:531 , PRO A:532 , PHE A:539 , PHE A:540 , PRO A:541 , ASP B:36 , SER B:37 , LEU B:38 , HOH B:86 , HOH B:100 , HOH B:135	BINDING SITE FOR RESIDUE SXM B 79

(no "SS Bond" information available for 3NY7)

(no "Cis Peptide Bond" information available for 3NY7)

(no "SAP(SNP)/Variant" information available for 3NY7)

Asymmetric/Biological Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CARRIER	PS50075	Carrier protein (CP) domain profile.	ACP_ECOLI	2-77	1	B:2-77
2	PHOSPHOPANTETHEINE	PS00012	Phosphopantetheine attachment site.	ACP_ECOLI	32-47	1	B:32-47
3	STAS	PS50801	STAS domain profile.	DAUA_ECOLI	449-559	1	A:440-550

(no "Exon" information available for 3NY7)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:118
 aligned with DAUA_ECOLI | P0AFR2 from UniProtKB/Swiss-Prot  Length:559

    Alignment length:130
                                   439       449       459       469       479       489       499       509       519       529       539       549       559
           DAUA_ECOLI   430 GIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFFPNRRAAMADL 559
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .------------....eeee........eeeeeee...hhhhhhhhhhhhhh......eeeeeeee....hhhhhhhhhhhhhhh....eeeee..hhhhhhhhhhh........eeee.hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------STAS  PDB: A:440-550 UniProt: 449-559                                                                           PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ny7 A 433 G------------SHMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFFPNRRAAMADL 550
                            |        -   |   440       450       460       470       480       490       500       510       520       530       540       550
                          433          434

Chain B from PDB  Type:PROTEIN  Length:77
 aligned with ACP_ECOLI | P0A6A8 from UniProtKB/Swiss-Prot  Length:78

    Alignment length:77
                                    11        21        31        41        51        61        71       
            ACP_ECOLI     2 STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA  78
               SCOP domains d3ny7b_ B: automated matches                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh.hhhhh....hhhhhhh.hhhhhhhhhhhhhhhhh...hhhhhh...hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) CARRIER  PDB: B:2-77 UniProt: 2-77                                          - PROSITE (1)
                PROSITE (2) ------------------------------PHOSPHOPANTETHEI------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------- Transcript
                 3ny7 B   2 STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA  78
                                    11        21        31        41        51        61        71

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Acyl carrier protein-like (148)

Superfamily: ACP-like (68)

Family: Acyl-carrier protein (ACP) (40)

Protein domain: automated matches (14)

Escherichia coli [TaxId: 562] (2)

d3ny7b_

(no "CATH Domain" information available for 3NY7)

(no "Pfam Domain" information available for 3NY7)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (DAUA_ECOLI | P0AFR2)

molecular function
	GO:0015183	L-aspartate transmembrane transporter activity	Enables the transfer of L-aspartate from one side of a membrane to the other. L-aspartate is the anion derived from aspartic acid.
	GO:0015138	fumarate transmembrane transporter activity	Enables the transfer of fumarate from one side of the membrane to the other. Fumarate is a key intermediate in metabolism and is formed in the TCA cycle from succinate and converted into malate.
	GO:0008271	secondary active sulfate transmembrane transporter activity	Catalysis of the secondary active transfer of sulfate from one side of the membrane to the other. Secondary active transport is catalysis of the transfer of a solute from one side of a membrane to the other, up its concentration gradient. The transporter binds the solute and undergoes a series of conformational changes. Transport works equally well in either direction and is driven by a chemiosmotic source of energy. Chemiosmotic sources of energy include uniport, symport or antiport.
	GO:0015141	succinate transmembrane transporter activity	Enables the transfer of succinate, the dianion of ethane dicarboxylic acid, from one side of the membrane to the other.
	GO:0015116	sulfate transmembrane transporter activity	Enables the transfer of sulfate ions, SO4(2-), from one side of a membrane to the other.
biological process
	GO:0089712	L-aspartate transmembrane transport	The directed movement of L-aspartate across a membrane.
	GO:0015810	aspartate transport	The directed movement of aspartate, the anion of aspartic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015741	fumarate transport	The directed movement of fumarate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0071422	succinate transmembrane transport	A process in which a succinate ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:1902358	sulfate transmembrane transport	The directed movement of sulfate across a membrane.
	GO:0008272	sulfate transport	The directed movement of sulfate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B (ACP_ECOLI | P0A6A8)

molecular function
	GO:0000036	ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process	Interacting selectively and non-covalently with the attachment site of the phosphopantetheine prosthetic group of an acyl carrier protein (ACP) as part of the process of fatty acid biosynthesis.
	GO:0000035	acyl binding	Interacting selectively and non-covalently with an acyl group, any group formally derived by removal of the hydroxyl group from the acid function of a carboxylic acid.
	GO:0031177	phosphopantetheine binding	Interacting selectively and non-covalently with phosphopantetheine, the vitamin pantetheine 4'-(dihydrogen phosphate).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006633	fatty acid biosynthetic process	The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
	GO:0006631	fatty acid metabolic process	The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
	GO:0009245	lipid A biosynthetic process	The chemical reactions and pathways resulting in the formation of lipid A, the glycolipid group of bacterial lipopolysaccharides, consisting of four to six fatty acyl chains linked to two glucosamine residues. Further modifications of the backbone are common.
	GO:0008610	lipid biosynthetic process	The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SXM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ny7)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ny7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACP_ECOLI \| P0A6A8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	DAUA_ECOLI \| P0AFR2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACP_ECOLI \| P0A6A8
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	DAUA_ECOLI \| P0AFR2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ACP_ECOLI \| P0A6A8	:	1acp 1l0h 1l0i 1t8k 2fac 2fad 2fae 2fhs 2k92 2k93 2k94 3ejb 3ejd 3eje 5usr

(no "Related Entries Specified in the PDB File" available for 3NY7)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 3)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (29, 29)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File