|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3NLA) |
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3NLA) |
Cis Peptide Bonds (1, 40)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3NLA) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3NLA) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:73 aligned with ANP3_LYCDA | P35753 from UniProtKB/Swiss-Prot Length:134 Alignment length:73 10 20 30 40 50 60 70 ANP3_LYCDA 1 NKASVVANQLIPINTALTLIMMKAEVVTPMGIPAEEIPNLVGMQVNRAVPLGTTLMPDMVKNYEDGTTSPGLK 73 SCOP domains d3nlaa_ A: Type III antifreeze protein, AFP III SCOP domains CATH domains 3nlaA00 A:1-73 Type Iii Antifreeze Protein Isoform Hplc 12 CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---AFP_LIKE PDB: A:4-63 UniProt: 4-63 ---------- PROSITE Transcript ------------------------------------------------------------------------- Transcript 3nla A 1 NKASVVANQLIPINTALTLIMMKAEVVTPMGIPAEEIPNLVGMQVNRAVPLGTTLMPDMVKNYEDGTTSPGLK 73 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3NLA) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (ANP3_LYCDA | P35753)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|