Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  COMPLEX OF 6-HYDROXY-L-NICOTINE OXIDASE WITH FINAL KETONE PRODUCT FORMED DURING CATALYTIC TURNOVER
 
Authors :  G. S. Kachalova, H. D. Bartunik
Date :  14 Jun 10  (Deposition) - 23 Mar 11  (Release) - 10 Aug 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  X
Biol. Unit 1:  X  (2x)
Keywords :  Enanthiomeric Substrate-Inhibitor, Flavoenzymes, Nicotine Degradation, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. S. Kachalova, G. P. Bourenkov, T. Mengesdorf, S. Schenk, H. R. Maun, M. Burghammer, C. Riekel, K. Decker, H. D. Bartunik
Crystal Structure Analysis Of Free And Substrate-Bound 6-Hydroxy-L-Nicotine Oxidase From Arthrobacter Nicotinovorans.
J. Mol. Biol. V. 396 785 2010
PubMed-ID: 20006620  |  Reference-DOI: 10.1016/J.JMB.2009.12.009
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 6-HYDROXY-L-NICOTINE OXIDASE
    Chains: X
    EC Number: 1.5.3.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTRC99A
    Expression System Strain: JM105
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: 6-HLNO
    Organism Scientific: ARTHROBACTER NICOTINOVORANS
    Organism Taxid: 29320

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : X
Biological Unit 1 (2x): X

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 4)

Asymmetric Unit (4, 4)
No.NameCountTypeFull Name
1FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2GP71Ligand/Ion(1R)-2-{[(S)-(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PENTADECANOYLOXY)METHYL]ETHYL (12E)-HEXADECA-9,12-DIENOATE
3HNL1Ligand/Ion5-[(2S)-1-METHYLPYRROLIDIN-2-YL]PYRIDIN-2-OL
4HNM1Ligand/Ion1-(6-HYDROXYPYRIDIN-3-YL)-4-(METHYLAMINO)BUTAN-1-ONE
Biological Unit 1 (4, 8)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
2GP72Ligand/Ion(1R)-2-{[(S)-(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PENTADECANOYLOXY)METHYL]ETHYL (12E)-HEXADECA-9,12-DIENOATE
3HNL2Ligand/Ion5-[(2S)-1-METHYLPYRROLIDIN-2-YL]PYRIDIN-2-OL
4HNM2Ligand/Ion1-(6-HYDROXYPYRIDIN-3-YL)-4-(METHYLAMINO)BUTAN-1-ONE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR X:59 , ASN X:166 , MET X:167 , LEU X:198 , TYR X:311 , PHE X:326 , TRP X:371 , GLY X:406 , TYR X:407 , FAD X:434BINDING SITE FOR RESIDUE HNL X 433
2AC2SOFTWAREGLY X:8 , GLY X:9 , GLY X:10 , PHE X:11 , SER X:12 , GLU X:31 , GLY X:32 , GLY X:37 , GLY X:38 , ARG X:39 , ALA X:40 , GLY X:56 , GLY X:57 , ALA X:58 , TYR X:59 , THR X:224 , VAL X:226 , ALA X:254 , THR X:255 , PRO X:256 , TRP X:361 , LEU X:366 , PHE X:367 , PRO X:370 , TRP X:371 , GLY X:397 , SER X:398 , GLY X:406 , TYR X:407 , ILE X:408 , HNL X:433 , HOH X:453 , HOH X:469 , HOH X:476 , HOH X:505 , HOH X:530 , HOH X:674 , HOH X:746 , HOH X:1008 , HOH X:1011BINDING SITE FOR RESIDUE FAD X 434
3AC3SOFTWAREGLY X:105 , THR X:115 , PHE X:159 , MET X:180 , VAL X:195 , HOH X:733 , HOH X:741 , HOH X:1032 , HOH X:1044BINDING SITE FOR RESIDUE GP7 X 435
4AC4SOFTWARETYR X:59 , PHE X:85 , TRP X:163 , VAL X:195 , LEU X:198 , GLU X:300 , TYR X:311 , HOH X:660 , HOH X:693 , HOH X:918 , HOH X:1151BINDING SITE FOR RESIDUE HNM X 436

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NH3)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Thr X:266 -Pro X:267

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3NH3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3NH3)

(-) Exons   (0, 0)

(no "Exon" information available for 3NH3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain X from PDB  Type:PROTEIN  Length:425
 aligned with Q93NH4_PAENI | Q93NH4 from UniProtKB/TrEMBL  Length:425

    Alignment length:425
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420     
         Q93NH4_PAENI     1 MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS 425
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhh...eeee...........eee.......eee....ee....hhhhhhhhhhhh..ee......ee...............hhhhhhhhhhhhhhhhhhhh............hhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhh..eee..hhhhhhhhhhh....ee....eeeee.....eeeee.....eeeeeeee..hhhhhhhheee...hhhhhhhhhhh....eeeeeeeee.....eeee......eeeeeee....eeeeeeeee.......hhhhhhhhhhhhh...eeeeee...................hhhhhh.hhhhh....eee.hhhhh.....hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nh3 X   1 MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS 425
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3NH3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NH3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3NH3)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain X   (Q93NH4_PAENI | Q93NH4)
molecular function
    GO:0018531    (S)-6-hydroxynicotine oxidase activity    Catalysis of the reaction: (S)-6-hydroxynicotine + H(2)O + O(2) = 6-hydroxypseudooxynicotine + H(2)O(2).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GP7  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HNL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HNM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr X:266 - Pro X:267   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3nh3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q93NH4_PAENI | Q93NH4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.5.3.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q93NH4_PAENI | Q93NH4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q93NH4_PAENI | Q93NH4: 3k7m 3k7q 3k7t 3ng7 3ngc 3nho 3nk0 3nk1 3nk2 3nn0 3nn6

(-) Related Entries Specified in the PDB File

3k7m 3k7q 3ngc 3nho 3nk0 3nk1 3nk2 3nn0 3nn6