|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 22)| Asymmetric Unit (4, 22) Biological Unit 1 (3, 63) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3MC3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3MC3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3MC3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3MC3) |
Exons (0, 0)| (no "Exon" information available for 3MC3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with Q97Z18_SULSO | Q97Z18 from UniProtKB/TrEMBL Length:133 Alignment length:121 22 32 42 52 62 72 82 92 102 112 122 132 Q97Z18_SULSO 13 QKKKILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFFDMAKENGVKMYVCVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTLEADRTLFF 133 SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --DrsE-3mc3A01 A:15-133 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 3mc3 A 13 QkkkILIVVTHGPEDLDRTYAPLFmASISASmEYETSVFFmIkGPkLLDkkWQEEERkkGGNPFIHFFDmAkENGVkmYVcVQSLkDmCHmkEDDVVEGIELVGGSTLIDLTLEADRTLFF 133 ||| 22 32 | 42 | 52| | | 62| |72 82 | ||92| | 102|| 112 122 132 ||| 37-MSE 44-MSE 53-MSE| || 70-MLY 82-MSE || | | | || 14-MLY 55-MLY || 71-MLY 84-MLY|| | | | || 15-MLY 58-MLY| 89-MLY | | || 16-MLY 62-MLY 90-MSE | | || 63-MLY 93-CSX| | || 98-MLY|| 100-MSE 103-MSE 104-MLY
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3MC3) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3MC3) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3MC3)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|