Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE BACTERIOCIN LLPA FROM PSEUDOMONAS SP.
 
Authors :  A. Garcia-Pino, R. Loris
Date :  16 Mar 10  (Deposition) - 23 Mar 11  (Release) - 10 Apr 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Monocot Mannose-Binding Lectin, Bacteriocin, Llpa, Pseudomonas, Bacterial Toxin, Siras, Antimicrobial Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. G. Ghequire, A. Garcia-Pino, E. K. Lebbe, S. Spaepen, R. Loris, R. De Mot
Structural Determinants For Activity And Specificity Of The Bacterial Toxin Llpa
Plos Pathog. V. 9 03199 2013
PubMed-ID: 23468636  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1003199

(-) Compounds

Molecule 1 - PUTIDACIN L1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: LLPA
    Organism Scientific: PSEUDOMONAS SP.
    Organism Taxid: 216978
    Strain: BW11M1
    Synonym: BACTERIOCIN LLPA

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3M7H)

(-) Sites  (0, 0)

(no "Site" information available for 3M7H)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3M7H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3M7H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3M7H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3M7H)

(-) Exons   (0, 0)

(no "Exon" information available for 3M7H)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:272
 aligned with Q8GEJ9_PSEPU | Q8GEJ9 from UniProtKB/TrEMBL  Length:276

    Alignment length:272
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273  
         Q8GEJ9_PSEPU     4 RTRIPFNGVGTSVLPAYQTLSAGQYLLSPNQRFKLLLQGDGNLVIQDNGATVWVANEQQPFSSTIPLRNKKAPLAFYVQYGAFLDDYSRRRVWLTDNSTFTSNDQWNRTHLVLQDDGNIVLVDSLALWNGTPAIPLVPGAIDSLLLAPGSELVQGVVYGAGASKLVFQGDGNLVAYGPNGAATWNAGTQGKGAVRAVFQGDGNLVVYGAGNAVLWHSHTGGHASAVLRLQANGSIAILDEKPVWARFGFQPTYRHIRKINPDQKPIDIWTWH 275
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.......ee...ee.....eee.....eeeee.....eeeee..eeeee.......eeeee........eeee...eeeeehhh.eeeee........hhhhheeeee.....eeeeeeeeeee..............eee...eee....eeee..eeeee.....eeee.....eeee.........eeee.....eeee.....eeee.........eeee.....eeeeeeeeeee.........eeeee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3m7h A   4 RTRIPFNGVGTSVLPAYQTLSAGQYLLSPNQRFKLLLQGDGNLVIQDNGATVWVANEQQPFSSTIPLRNKKAPLAFYVQYGAFLDDYSRRRVWLTDNSTFTSNDQWNRTHLVLQDDGNIVLVDSLALWNGTPAIPLVPGAIDSLLLAPGSELVQGVVYGAGASKLVFQGDGNLVAYGPNGAATWNAGTQGKGAVRAVFQGDGNLVVYGAGNAVLWHSHTGGHASAVLRLQANGSIAILDEKPVWARFGFQPTYRHIRKINPDQKPIDIWTWH 275
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273  


Chain B from PDB  Type:PROTEIN  Length:270
 aligned with Q8GEJ9_PSEPU | Q8GEJ9 from UniProtKB/TrEMBL  Length:276

    Alignment length:272
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273  
         Q8GEJ9_PSEPU     4 RTRIPFNGVGTSVLPAYQTLSAGQYLLSPNQRFKLLLQGDGNLVIQDNGATVWVANEQQPFSSTIPLRNKKAPLAFYVQYGAFLDDYSRRRVWLTDNSTFTSNDQWNRTHLVLQDDGNIVLVDSLALWNGTPAIPLVPGAIDSLLLAPGSELVQGVVYGAGASKLVFQGDGNLVAYGPNGAATWNAGTQGKGAVRAVFQGDGNLVVYGAGNAVLWHSHTGGHASAVLRLQANGSIAILDEKPVWARFGFQPTYRHIRKINPDQKPIDIWTWH 275
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.......ee...eee....eee.....eeeee.....eeeee..eeeee.......eeeee.--.....eeee...eeeee....eeeee........hhhhheeeee.....eeeeeeeeeee..............eee...ee......eee..eeeee.....eeee.....eeee.........eeee.....eeee.hhh.eeee.........eeee.....eeeeeeeeeee.........eeeee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3m7h B   4 RTRIPFNGVGTSVLPAYQTLSAGQYLLSPNQRFKLLLQGDGNLVIQDNGATVWVANEQQPFSSTIPL--KKAPLAFYVQYGAFLDDYSRRRVWLTDNSTFTSNDQWNRTHLVLQDDGNIVLVDSLALWNGTPAIPLVPGAIDSLLLAPGSELVQGVVYGAGASKLVFQGDGNLVAYGPNGAATWNAGTQGKGAVRAVFQGDGNLVVYGAGNAVLWHSHTGGHASAVLRLQANGSIAILDEKPVWARFGFQPTYRHIRKINPDQKPIDIWTWH 275
                                    13        23        33        43        53        63      | 73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273  
                                                                                             70 73
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3M7H)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3M7H)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3M7H)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3M7H)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3m7h)
 
  Sites
(no "Sites" information available for 3m7h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3m7h)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3m7h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8GEJ9_PSEPU | Q8GEJ9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8GEJ9_PSEPU | Q8GEJ9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8GEJ9_PSEPU | Q8GEJ9: 3m7j 4gc1 4gc2

(-) Related Entries Specified in the PDB File

3m7j LLPA IN COMPLEX WITH MET-MANNOSE