Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A RIBOSOMAL METHYLTRANSFERASE
 
Authors :  M. Galimand, E. Schmitt, M. Panvert, Y. Mechulam, P. Courvalin
Date :  12 Mar 10  (Deposition) - 14 Apr 10  (Release) - 14 Apr 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.28
Chains :  Asym./Biol. Unit :  A
Keywords :  Mtase Domain, Pua Domain, Rrm Motif, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Galimand, E. Schmitt, M. Panvert, Y. Mechulam, P. Courvalin
Structure Of An Rna Methyltransferase
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - NOL1/NOP2/SUN FAMILY PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: B834
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: EFMM
    Organism Scientific: ENTEROCOCCUS FAECIUM
    Organism Taxid: 1352
    Strain: CIP 54-32
    Synonym: RRNA METHYLTRANSFERASE, EFM METHYLTRANSFERASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 7)

Asymmetric/Biological Unit (1, 7)
No.NameCountTypeFull Name
1MSE7Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3M4X)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3M4X)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ala A:115 -Pro A:116

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3M4X)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3M4X)

(-) Exons   (0, 0)

(no "Exon" information available for 3M4X)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:440
 aligned with Q3Y1J9_ENTFC | Q3Y1J9 from UniProtKB/TrEMBL  Length:456

    Alignment length:449
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446         
         Q3Y1J9_ENTFC     7 TLPQQFIKKYRLLLGEEASDFFSALEQGSVKKGFRWNPLKPAGLDMVQTYHSEELQPAPYSNEGFLGTVNGKSFLHQAGYEYSQEPSAMIVGTAAAAKPGEKVLDLCAAPGGKSTQLAAQMKGKGLLVTNEIFPKRAKILSENIERWGVSNAIVTNHAPAELVPHFSGFFDRIVVDAPCSGEGMFRKDPNAIKEWTEESPLYCQKRQQEILSSAIKMLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEEIPLTQSVSSGRSEWGSVAGLEKTIRIWPHKDQGEGHFVAKLTFHGQNQMHKEKKTRKKSKVQMTKEQEKLWTEFSNDFHYEATGRLLVFNDHLWEVPELAPSLDGLKVVRTGLHLGDFKKNRFEPSYALALATKKIENIPCLPITQKEWQSYTAGETFQRDGNQGWVLLVLDKIPVGFGKQVKGTVKNFFPKGLRF 455
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------Nol1_Nop2_Fmu-3m4xA01 A:81-301                                                                                                                                                                                               --------------------------------------------------Nol1_Nop2_Fmu_2-3m4xA02 A:352-453                                                                     -- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh.hhhhhhhhhhhh....eee......hhhhhhhhhh............eee......hhhhhh...ee....hhhhhhhhh.....eeee.....hhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh...eeee..hhhhhhhhhh..eeeeeee....hhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhheeeeeeeeeee...hhhhhhhhhhhhhhhh.eeee........ee.hhhhh...hhhh.eee.........eeeeeeee.......---------....hhhhhhhhhhhhhhh......eeeee..eeeee...........eeee.eeeeeee..eeeehhhhhhh..hhhhh.eeeehhhhhhhhhhh..ee.....eeeeeee..eeeeeeeee..eeee..hhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3m4x A   7 TLPQQFIKKYRLLLGEEASDFFSALEQGSVKKGFRWNPLKPAGLDmVQTYHSEELQPAPYSNEGFLGTVNGKSFLHQAGYEYSQEPSAmIVGTAAAAKPGEKVLDLCAAPGGKSTQLAAQmKGKGLLVTNEIFPKRAKILSENIERWGVSNAIVTNHAPAELVPHFSGFFDRIVVDAPCSGEGmFRKDPNAIKEWTEESPLYCQKRQQEILSSAIKmLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEEIPLTQSVSSGRSEWGSVAGLEKTIRIWPHKDQGEGHFVAKLTFHGQNQmH---------KVQmTKEQEKLWTEFSNDFHYEATGRLLVFNDHLWEVPELAPSLDGLKVVRTGLHLGDFKKNRFEPSYALALATKKIENIPCLPITQKEWQSYTAGETFQRDGNQGWVLLVLDKIPVGFGKQVKGTVKNFFPKGLRF 455
                                    16        26        36        46     |  56        66        76        86        96       106       116       126|      136       146       156       166       176       186   |   196       206       216      |226       236       246       256       266       276       286       296       306 ||      -  |  | 326       336       346       356       366       376       386       396       406       416       426       436       446         
                                                                        52-MSE                                     95-MSE                         127-MSE                                                        190-MSE                          223-MSE                                                                              308-MSE    319  |                                                                                                                                     
                                                                                                                                                                                                                                                                                                                                        309          322-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3M4X)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3M4X)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Clan: NADP_Rossmann (1239)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q3Y1J9_ENTFC | Q3Y1J9)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0008757    S-adenosylmethionine-dependent methyltransferase activity    Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3m4x)
 
  Cis Peptide Bonds
    Ala A:115 - Pro A:116   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3m4x
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q3Y1J9_ENTFC | Q3Y1J9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q3Y1J9_ENTFC | Q3Y1J9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3M4X)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3M4X)