|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3M0N) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3M0N) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3M0N) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3M0N) |
Exons (0, 0)| (no "Exon" information available for 3M0N) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:163 aligned with A5K2B2_PLAVS | A5K2B2 from UniProtKB/TrEMBL Length:172 Alignment length:163 19 29 39 49 59 69 79 89 99 109 119 129 139 149 159 169 A5K2B2_PLAVS 10 DQIAELLVESPLFSFNCAHFIAFKGFRETLHGHNYNVSLRLRGNIQGDGYVIDFSILKEKVRKVCKQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVNYMEVTVSESPSQKATVHRNI 172 SCOP domains d3m0na_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------PTPS-3m0nA01 A:18-171 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3m0n A 10 DQIAELLVESPLFSFNCAHFIAFKGFRATLHGHNYNVSLRLRGNIQGDGYVIDFSILKEKVRKVCKQLDHHFILPMYSDVLNIQEVNDNFKITCEDNSEYSFPKRDCVQIPIKHSSTEEIGLYILNQLIEEIDLPFLKTRSVNYMEVTVSESPSQKATVHRNI 172 19 29 39 49 59 69 79 89 99 109 119 129 139 149 159 169
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3M0N) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (A5K2B2_PLAVS | A5K2B2)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|