Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF GREEN ABALONE LYSIN DIMER
 
Authors :  N. Kresge, V. D. Vacquier, C. D. Stout
Date :  19 May 99  (Deposition) - 15 Mar 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Abalone Lysin, Fertilization Protein, Gamete Recognition Protein, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Kresge, V. D. Vacquier, C. D. Stout
The High Resolution Crystal Structure Of Green Abalone Sperm Lysin: Implications For Species-Specific Binding Of The Egg Receptor.
J. Mol. Biol. V. 296 1225 2000
PubMed-ID: 10698629  |  Reference-DOI: 10.1006/JMBI.2000.3533
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SPERM LYSIN
    CellSPERM
    ChainsA, B
    OrganGONAD
    OrganelleACROSOME GRANULE
    Organism ScientificHALIOTIS FULGENS
    Organism Taxid6456

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3LYN)

(-) Sites  (0, 0)

(no "Site" information available for 3LYN)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LYN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3LYN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LYN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LYN)

(-) Exons   (0, 0)

(no "Exon" information available for 3LYN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:122
 aligned with ELYS_HALFU | Q01381 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:122
                                    38        48        58        68        78        88        98       108       118       128       138       148  
           ELYS_HALFU    29 INKAYEVTMKIQIISGFDRQLTAWLRVHGRRLTNNQKKTLFFVNRRYMQTHWQNYMLWVKRKIKALGRPAAVGDYTRLGAEIGRRVDMVFFYNFLSGRKMIPPYSAYMAKLNALRPADVPVK 150
               SCOP domains d3lyna_ A: Lysin                                                                                                           SCOP domains
               CATH domains 3lynA00 A:11-132  [code=1.20.150.10, no name defined]                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh..hhhhhhhhhh........hhhhhhhh..hhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lyn A  11 INKAYEVTMKIQIISGFDRQLTAWLRVHGRRLTNNQKKTLFFVNRRYMQTHWQNYMLWVKRKIKALGRPAAVGDYTRLGAEIGRRVDMVFFYNFLSGRKMIPPYSAYMAKLNALRPADVPVK 132
                                    20        30        40        50        60        70        80        90       100       110       120       130  

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with ELYS_HALFU | Q01381 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:124
                                    38        48        58        68        78        88        98       108       118       128       138       148    
           ELYS_HALFU    29 INKAYEVTMKIQIISGFDRQLTAWLRVHGRRLTNNQKKTLFFVNRRYMQTHWQNYMLWVKRKIKALGRPAAVGDYTRLGAEIGRRVDMVFFYNFLSGRKMIPPYSAYMAKLNALRPADVPVKNH 152
               SCOP domains d3lynb_ B: Lysin                                                                                                             SCOP domains
               CATH domains 3lynB00 B:11-134  [code=1.20.150.10, no name defined]                                                                        CATH domains
           Pfam domains (1) Egg_lysin-3lynB01 B:11-131                                                                                               --- Pfam domains (1)
           Pfam domains (2) Egg_lysin-3lynB02 B:11-131                                                                                               --- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhhhhh........hhhhhhhh..hhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lyn B  11 INKAYEVTMKIQIISGFDRQLTAWLRVHGRRLTNNQKKTLFFVNRRYMQTHWQNYMLWVKRKIKALGRPAAVGDYTRLGAEIGRRVDMVFFYNFLSGRKMIPPYSAYMAKLNALRPADVPVKNH 134
                                    20        30        40        50        60        70        80        90       100       110       120       130    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ELYS_HALFU | Q01381)
biological process
    GO:0007338    single fertilization    The union of male and female gametes to form a zygote.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3lyn)
 
  Sites
(no "Sites" information available for 3lyn)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3lyn)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lyn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ELYS_HALFU | Q01381
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ELYS_HALFU | Q01381
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LYN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LYN)