Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF STRINGENT STARVATION PROTEIN A HOMOLOG FROM HAEMOPHILUS INFLUENZAE
 
Authors :  U. A. Ramagopal, R. Toro, S. K. Burley, S. C. Almo, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  27 Feb 10  (Deposition) - 23 Mar 10  (Release) - 23 Mar 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Gst-Superfamily, Sspa, Stringent Starvation Protein A Homolog, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  U. A. Ramagopal, R. Toro, S. K. Burley, S. C. Almo
Structure Of Stringent Starvation Protein A Homolog From Haemophilus Influenzae
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - STRINGENT STARVATION PROTEIN A HOMOLOG
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: BC-PSGX4(BC)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Gene: HI1441, SSPA
    Organism Scientific: HAEMOPHILUS INFLUENZAE
    Organism Taxid: 727

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 16)

Asymmetric/Biological Unit (1, 16)
No.NameCountTypeFull Name
1MSE16Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3LYK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LYK)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Val A:59 -Pro A:60
2His A:85 -Pro A:86
3Val B:59 -Pro B:60
4His B:85 -Pro B:86

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LYK)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GST_NTERPS50404 Soluble glutathione S-transferase N-terminal domain profile.SSPA_HAEIN9-87  1B:9-87
2GST_CTERPS50405 Soluble glutathione S-transferase C-terminal domain profile.SSPA_HAEIN92-212
 		  2A:92-201
B:92-201

(-) Exons   (0, 0)

(no "Exon" information available for 3LYK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:192
 aligned with SSPA_HAEIN | P45207 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:192
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199  
           SSPA_HAEIN    10 VMTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLMELNPYGTVPTLVDRDLVLFNSRIIMEYLDERFPHPPLMQVYPVSRAKDRLLMLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQMPYFMNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYMERVFTRDSFLQSVG 201
               SCOP domains d3lyka1 A:10-87 automated matches                                             d3lyka2 A:88-201 automated matches                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhh...eeee......hhhhhhhh......eeee..eeeehhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE GST_NTER  PDB: - UniProt: 9-87                                                ----GST_CTER  PDB: A:92-201 UniProt: 92-212                                                                        PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3lyk A  10 VmTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLmELNPYGTVPTLVDRDLVLFNSRIImEYLDERFPHPPLmQVYPVSRAKDRLLmLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQmPYFmNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYmERVFTRDSFLQSVG 201
                             |      19        29        39        49 |      59        69      | 79        89        99   |   109       119       129       139      |149|      159       169       179       189       199  
                             |                                      51-MSE                   76-MSE       89-MSE       103-MSE                                    146-MSE                                  187-MSE          
                            11-MSE                                                                                                                                    150-MSE                                               


Chain B from PDB  Type:PROTEIN  Length:196
 aligned with SSPA_HAEIN | P45207 from UniProtKB/Swiss-Prot  Length:212

    Alignment length:196
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195      
           SSPA_HAEIN     6 SKRSVMTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLMELNPYGTVPTLVDRDLVLFNSRIIMEYLDERFPHPPLMQVYPVSRAKDRLLMLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQMPYFMNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYMERVFTRDSFLQSVG 201
               SCOP domains d3lykb1 B:6-87 automated matches                                                  d3lykb2 B:88-201 automated matches                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------GST_N_3-3lykB03 B:13-87                                                    -------------GST_C-3lykB01 B:101-194                                                                       ------- Pfam domains (1)
           Pfam domains (2) -------GST_N_3-3lykB04 B:13-87                                                    -------------GST_C-3lykB02 B:101-194                                                                       ------- Pfam domains (2)
         Sec.struct. author .eeeeeeeee...hhhhhhhhhhhhhh.eeeeeee......hhhhhhhh......eeee..eeeehhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---GST_NTER  PDB: B:9-87 UniProt: 9-87                                            ----GST_CTER  PDB: B:92-201 UniProt: 92-212                                                                        PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lyk B   6 SLRSVmTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQALPEDLmELNPYGTVPTLVDRDLVLFNSRIImEYLDERFPHPPLmQVYPVSRAKDRLLmLRIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQmPYFmNEEFGLVDCYVAPLLWKLKHLGVEFTGTGSKAIKAYmERVFTRDSFLQSVG 201
                                 |  15        25        35        45     |  55        65        75|       85   |    95       105       115       125       135       145|   |  155       165       175       185 |     195      
                                11-MSE                                  51-MSE                   76-MSE       89-MSE       103-MSE                                    146-MSE                                  187-MSE          
                                                                                                                                                                          150-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LYK)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: GST_C (118)
(-)
Clan: Thioredoxin (367)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (SSPA_HAEIN | P45207)
molecular function
    GO:0001000    bacterial-type RNA polymerase core enzyme binding    Interacting selectively and non-covalently with the bacterial-type RNA polymerase core enzyme, typically consisting of two alpha, one beta, one beta prime, and one omega subunit.
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
biological process
    GO:0006749    glutathione metabolic process    The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3lyk)
 
  Cis Peptide Bonds
    His A:85 - Pro A:86   [ RasMol ]  
    His B:85 - Pro B:86   [ RasMol ]  
    Val A:59 - Pro A:60   [ RasMol ]  
    Val B:59 - Pro B:60   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lyk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSPA_HAEIN | P45207
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SSPA_HAEIN | P45207
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LYK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LYK)