|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 8)| Asymmetric Unit (3, 8) Biological Unit 1 (3, 16) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3LWC) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LWC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LWC) |
Exons (0, 0)| (no "Exon" information available for 3LWC) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:104 aligned with Q1MK54_RHIL3 | Q1MK54 from UniProtKB/TrEMBL Length:131 Alignment length:110 25 35 45 55 65 75 85 95 105 115 125 Q1MK54_RHIL3 16 MKMRKFTIADASLERSPGQEADISVGNLVDERHGGPITIGYGRYAPGQSLTETMAVDDVMIVLEGRLSVSTDGETVTAGPGEIVYMPKGETVTIRSHEEGALTAYVTYPH 125 SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -----------------EutQ-3lwcA0 1 A:33-125 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 3lwc A 16 mKmRKFTIADASLERSPGQEADISVGNL------GPITIGYGRYAPGQSLTETmAVDDVmIVLEGRLSVSTDGETVTAGPGEIVYmPKGETVTIRSHEEGALTAYVTYPH 125 | | 25 35 | - | 55 65 | 75 85 95 | 105 115 125 | | 43 50 69-MSE | 101-MSE 16-MSE 75-MSE 18-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3LWC) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LWC) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3LWC)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|