Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE C-TERMINAL DOMAIN OF ANTI-SIGMA FACTOR ANTAGONIST STAS FROM RHODOBACTER SPHAEROIDES
 
Authors :  B. Nocek, N. Marshall, J. Davidoff, L. Freeman, A. Joachimiak, Midwest For Structural Genomics (Mcsg)
Date :  27 Jan 10  (Deposition) - 09 Mar 10  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A (1x),B (1x)
Biol. Unit 2:  A  (1x)
Biol. Unit 3:  B  (1x)
Keywords :  Mcsg, Psi, Structural Genomics, Protein Structure Initiative, Midwest Center For Structural Genomics, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Nocek, N. Marshall, J. Davidoff, L. Freeman, A. Joachimiak
Crystal Structure Of The C-Terminal Domain Of Anti-Sigma Factor Antagonist Stas From Rhodobacter Sphaeroides
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ANTISIGMA-FACTOR ANTAGONIST STAS
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG19
    Expression System Strain: BL21-DE3
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 391-485
    Gene: RSP_4257
    Organism Scientific: RHODOBACTER SPHAEROIDES
    Organism Taxid: 272943
    Strain: ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A (1x)B (1x)
Biological Unit 2 (1x): A 
Biological Unit 3 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3LKL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LKL)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Glu B:71 -Gly B:72

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LKL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LKL)

(-) Exons   (0, 0)

(no "Exon" information available for 3LKL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with Q3HKG0_RHOS4 | Q3HKG0 from UniProtKB/TrEMBL  Length:496

    Alignment length:93
                                   398       408       418       428       438       448       458       468       478   
         Q3HKG0_RHOS4   389 QLFAVSSELSACGRARTYRVEGQLFYGSVEDFMAAFDFREPLERVTIDVSRAHIWDISSVQALDMAVLKFRREGAEVRIVGMNEASETLVDRL 481
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....eeeeeeeeeehhhhhhhhhhh........eeeeeeeeeee.hhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                 3lkl A  -1 NAFAVSSELSACGRARTYRVEGQLFYGSVEDFmAAFDFREPLERVTIDVSRAHIWDISSVQALDmAVLKFRREGAEVRIVGmNEASETLVDRL  91
                                     8        18        28  |     38        48        58    |   68        78 |      88   
                                                           31-MSE                          63-MSE           80-MSE       


Chain B from PDB  Type:PROTEIN  Length:88
 aligned with Q3HKG0_RHOS4 | Q3HKG0 from UniProtKB/TrEMBL  Length:496

    Alignment length:93
                                   399       409       419       429       439       449       459       469       479   
         Q3HKG0_RHOS4   390 LFAVSSELSACGRARTYRVEGQLFYGSVEDFMAAFDFREPLERVTIDVSRAHIWDISSVQALDMAVLKFRREGAEVRIVGMNEASETLVDRLA 482
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------S     TAS-3lklB01 B:7-92                                                               Pfam domains (1)
           Pfam domains (2) -------S     TAS-3lklB02 B:7-92                                                               Pfam domains (2)
         Sec.struct. author .eeeeee.-----.eeeeeeeeehhhhhhhhhh.........eeeeeeeeeee.hhhhhhhhhhhhhhhhhhh.eeeeehhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                 3lkl B   0 AFAVSSEL-----ARTYRVEGQLFYGSVEDFmAAFDFREPLERVTIDVSRAHIWDISSVQALDmAVLKFRREGAEVRIVGmNEASETLVDRLA  92
                                   | -   |    19        29 |      39        49        59   |    69        79|       89   
                                   7    13                31-MSE                          63-MSE           80-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3LKL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LKL)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: STAS (15)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q3HKG0_RHOS4 | Q3HKG0)
molecular function
    GO:0008271    secondary active sulfate transmembrane transporter activity    Catalysis of the secondary active transfer of sulfate from one side of the membrane to the other. Secondary active transport is catalysis of the transfer of a solute from one side of a membrane to the other, up its concentration gradient. The transporter binds the solute and undergoes a series of conformational changes. Transport works equally well in either direction and is driven by a chemiosmotic source of energy. Chemiosmotic sources of energy include uniport, symport or antiport.
    GO:0015116    sulfate transmembrane transporter activity    Enables the transfer of sulfate ions, SO4(2-), from one side of a membrane to the other.
biological process
    GO:1902358    sulfate transmembrane transport    The directed movement of sulfate across a membrane.
    GO:0008272    sulfate transport    The directed movement of sulfate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3lkl)
 
  Cis Peptide Bonds
    Glu B:71 - Gly B:72   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lkl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q3HKG0_RHOS4 | Q3HKG0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q3HKG0_RHOS4 | Q3HKG0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LKL)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LKL)