|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 3LGM) |
(no "Cis Peptide Bond" information available for 3LGM) |
(no "SAP(SNP)/Variant" information available for 3LGM) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 3LGM) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with HDOX2_STAAN | Q7A827 from UniProtKB/Swiss-Prot Length:108 Alignment length:110 1 | 8 18 28 38 48 58 68 78 88 98 108 HDOX2_STAAN - --MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK 108 SCOP domains d3lgma_ A: Hypothetical protein PG130 (SAV0165) SCOP domains CATH domains 3lgmA00 A:-1-108 [code=3.30.70.900, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---ABM PDB: A:2-93 UniProt: 2-93 --------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 3lgm A -1 AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK 108 8 18 28 38 48 58 68 78 88 98 108 Chain B from PDB Type:PROTEIN Length:110 aligned with HDOX2_STAAN | Q7A827 from UniProtKB/Swiss-Prot Length:108 Alignment length:110 1 | 8 18 28 38 48 58 68 78 88 98 108 HDOX2_STAAN - --MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK 108 SCOP domains d3lgmb_ B: Hypothetical protein PG130 (SAV0165) SCOP domains CATH domains 3lgmB00 B:-1-108 [code=3.30.70.900, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---ABM PDB: B:2-93 UniProt: 2-93 --------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 3lgm B -1 AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK 108 8 18 28 38 48 58 68 78 88 98 108
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 3LGM) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (HDOX2_STAAN | Q7A827)
|
|
|
|
|
|
|