|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)| Asymmetric Unit (3, 7) Biological Unit 1 (3, 14) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3KSP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3KSP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3KSP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3KSP) |
Exons (0, 0)| (no "Exon" information available for 3KSP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:129 aligned with B1YH80_EXIS2 | B1YH80 from UniProtKB/TrEMBL Length:128 Alignment length:129 1 | 9 19 29 39 49 59 69 79 89 99 109 119 B1YH80_EXIS2 - -MEPSAKHLQLQTLLSERHAYLMEGNREAMHQLLSSDFSFIDGQGRQFDAETYLDHYVDPDQIQWSNQISESMVVEVFETTALVQEIVEDHFSYGRSMYIGRFRSVSLYHWANEGWKWHFHQLTPLDPS 128 SCOP domains --------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------SnoaL_3-3kspA01 A:10-127 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript 3ksp A 0 GmEPSAKHLQLQTLLSERHAYLmEGNREAmHQLLSSDFSFIDGQGRQFDAETYLDHYVDPDQIQWSNQISESmVVEVFETTALVQEIVEDHFSYGRSmYIGRFRSVSLYHWANEGWKWHFHQLTPLDPS 128 | 9 19 | 29 39 49 59 69 | 79 89 |99 109 119 | 22-MSE 29-MSE 72-MSE 97-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3KSP) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3KSP) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3KSP)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|