3K88 - JenaLib

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:59 , HOH A:82 , HOH A:104 , HOH A:143 , HOH A:157 , HOH A:162 , HOH A:220 , THR A:1048 , CYS A:1049 , SER A:1050 , ALA A:1051 , CYS A:1065 , ILE A:1066 , ASN A:1067 , LYS A:1069 , ALA A:1099 , SER A:1144 , TYR A:1166 , NAD A:1501 , SER B:78 , ASN B:79 , GLY B:80 , ILE B:136 , HOH B:274	BINDING SITE FOR RESIDUE FAD A 1500
2	AC2	SOFTWARE	HOH A:56 , HOH A:62 , HOH A:82 , HOH A:128 , HOH A:143 , HOH A:164 , HOH A:191 , HOH A:202 , HOH A:215 , ARG A:1023 , LEU A:1026 , ALA A:1051 , HIS A:1145 , TYR A:1166 , ARG A:1169 , FAD A:1500 , SER B:54 , ASP B:57	BINDING SITE FOR RESIDUE NAD A 1501
3	AC3	SOFTWARE	THR B:48 , CYS B:49 , SER B:50 , ALA B:51 , CYS B:65 , ILE B:66 , ASN B:67 , SER B:70 , TYR B:71 , ALA B:99 , GLY B:100 , VAL B:104 , PRO B:105 , MET B:106 , ARG B:109 , TYR B:166 , HOH B:204 , HOH B:237 , HOH B:244 , HOH B:266 , HOH B:267 , HOH B:276 , HOH B:277 , HOH B:281 , NAD B:501	BINDING SITE FOR RESIDUE FAD B 500
4	AC4	SOFTWARE	SER A:1054 , CYS A:1056 , ASP A:1057 , ARG B:23 , LEU B:26 , LYS B:113 , GLN B:116 , HIS B:145 , TYR B:166 , ARG B:169 , HOH B:191 , HOH B:196 , HOH B:202 , HOH B:215 , HOH B:222 , HOH B:242 , HOH B:262 , HOH B:268 , HOH B:276 , HOH B:284 , HOH B:288 , HOH B:297 , FAD B:500	BINDING SITE FOR RESIDUE NAD B 501

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:164
 aligned with TFTC_BURCE | O87008 from UniProtKB/Swiss-Prot  Length:179

    Alignment length:164
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173    
          TFTC_BURCE     14 FETVASFDFRDALSKASTPVTVVATNGPFGLAGLTCSAVCSVCDRPPTVLLCINRKSYAAGIIKSNGVLSVNWLAAGQAVISQTFAGVGSVPMEERFADKGWQTIATGAPYRMDAAVSFDCTIANIVDVGSHSVIFAEVVARNHAEECTPLIYHRRQYATTRSL  177
               SCOP domains d3k88a_ A: automated matches                                                                                                                                         SCOP domains
               CATH domains 3k88A00 A:1014-1177 Electron Transport, Fmn-binding Protein; Chain A                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhh.eee.eeeee......eeeee..eeeee....eeeeeee..hhhhhhhhhhheeeeee.hhhhhhhhhhhh.....hhhhh.....ee.......ee....eeeeeeeeeeeee..eeeeeeeeeee.........eee..eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3k88 A 1014 FETVASFDFRDALSKASTPVTVVATNGPFGLAGLTCSAVCSVCDRPPTVLLCINRKSYAAGIIKSNGVLSVNWLAAGQAVISQTFAGVGSVPMEERFADKGWQTIATGAPYRMDAAVSFDCTIANIVDVGSHSVIFAEVVARNHAEECTPLIYHRRQYATTRSL 1177
                                  1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143      1153      1163      1173

Chain B from PDB  Type:PROTEIN  Length:164
 aligned with TFTC_BURCE | O87008 from UniProtKB/Swiss-Prot  Length:179

    Alignment length:164
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173    
          TFTC_BURCE     14 FETVASFDFRDALSKASTPVTVVATNGPFGLAGLTCSAVCSVCDRPPTVLLCINRKSYAAGIIKSNGVLSVNWLAAGQAVISQTFAGVGSVPMEERFADKGWQTIATGAPYRMDAAVSFDCTIANIVDVGSHSVIFAEVVARNHAEECTPLIYHRRQYATTRSL  177
               SCOP domains d3k88b_ B: automated matches                                                                                                                                         SCOP domains
               CATH domains 3k88B00 B:14-177 Electron Transport, Fmn-binding Protein; Chain A                                                                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhh.eee.eeeee......eeeee..eeeee....eeeeeee..hhhhhhhhhhheeeeee....hhhhhhhhh......hhhhhh...ee.......ee....eeeeeeeeeeeee..eeeeeeeeeee.........eee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3k88 B   14 FETVASFDFRDALSKASTPVTVVATNGPFGLAGLTCSAVCSVCDRPPTVLLCINRKSYAAGIIKSNGVLSVNWLAAGQAVISQTFAGVGSVPMEERFADKGWQTIATGAPYRMDAAVSFDCTIANIVDVGSHSVIFAEVVARNHAEECTPLIYHRRQYATTRSL  177
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (TFTC_BURCE | O87008)

molecular function
	GO:0010181	FMN binding	Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016646	oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-NH group acts as a hydrogen or electron donor and reduces NAD or NADP.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0019439	aromatic compound catabolic process	The chemical reactions and pathways resulting in the breakdown of aromatic compounds, any substance containing an aromatic carbon ring.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:1058 - Pro A:1059	[ RasMol ]
		Arg B:58 - Pro B:59	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3k88
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TFTC_BURCE \| O87008
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)