|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 14)| Asymmetric Unit (2, 14) Biological Unit 1 (1, 16) Biological Unit 2 (1, 8) |
Sites (14, 14)
Asymmetric Unit (14, 14)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3K04) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3K04) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3K04) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3K04) |
Exons (0, 0)| (no "Exon" information available for 3K04) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:90 aligned with Q81HW2_BACCR | Q81HW2 from UniProtKB/TrEMBL Length:114 Alignment length:91 32 42 52 62 72 82 92 102 112 Q81HW2_BACCR 23 EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKK 113 SCOP domains ------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 3k04 A 23 EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGD-TPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP 112 32 42 52 62 | | 71 81 91 101 111 66 | 67 Chain B from PDB Type:PROTEIN Length:95 aligned with Q81HW2_BACCR | Q81HW2 from UniProtKB/TrEMBL Length:114 Alignment length:96 28 38 48 58 68 78 88 98 108 Q81HW2_BACCR 19 WKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKE 114 SCOP domains ------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains (1) ----------Ion_trans_2-3k04B01 B:29-102 - ----------- Pfam domains (1) Pfam domains (2) ----------Ion_trans_2-3k04B02 B:29-102 - ----------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3k04 B 19 AKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGD-TPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR 113 28 38 48 58 |67 77 87 97 107 66 | 67
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3K04) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3K04) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q81HW2_BACCR | Q81HW2)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|