|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3JS5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3JS5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3JS5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3JS5) |
Exons (0, 0)| (no "Exon" information available for 3JS5) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:156 aligned with C4LSE7_ENTHI | C4LSE7 from UniProtKB/TrEMBL Length:157 Alignment length:156 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149 C4LSE7_ENTHI - -MKLLFVCLGNICRSPAAEAVMKKVIQNHHLTEKYICDSAGTCSYHEGQQADSRMRKVGKSRGYQVDSISRPVVSSDFKNFDYIFAMDNDNYYELLDRCPEQYKQKIFKMVDFCTTIKTTEVPDPYYGGEKGFHRVIDILEDACENLIIKLEEGKL 155 SCOP domains d3js5a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ---LMWPc-3js5A01 A:3-147 -------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 3js5 A 0 SMKLLFVCLGNICRSPAAEAVMKKVIQNHHLTEKYICDSAGTCSYHEGQQADSRMRKVGKSRGYQVDSISRPVVSSDFKNFDYIFAMDNDNYYELLDRCPEQYKQKIFKMVDFCTTIKTTEVPDPYYGGEKGFHRVIDILEDACENLIIKLEEGKL 155 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3JS5) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (C4LSE7_ENTHI | C4LSE7)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|