|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 13)| Asymmetric Unit (4, 13) Biological Unit 1 (2, 56) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3I4P) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3I4P) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3I4P) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3I4P) |
Exons (0, 0)| (no "Exon" information available for 3I4P) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:153 aligned with A9CIH8_AGRFC | A9CIH8 from UniProtKB/TrEMBL Length:162 Alignment length:153 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 A9CIH8_AGRFC 1 MDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSIEWLKRFSEVVSEFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRMIAKIEIRDVSSAFAMEQIKYTTELPLDYML 153 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -3i4pA01 A:2-53 ---------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3i4p A 1 mDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKmEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSIEWLKRFSEVVSEFPEVVEFYRmSGDVDYLLRVVVPDIAAYDAFYKRmIAKIEIRDVSSAFAmEQIKYTTELPLDYmL 153 | 10 20 30 40| 50 60 70 80 90 100 110 120 | 130 140 150 | | 41-MSE 98-MSE 123-MSE 138-MSE 152-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3I4P) |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3I4P) |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (A9CIH8_AGRFC | A9CIH8)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|