Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PLP-DEPENDENT ACYL-COA TRANSFERASE CQSA
 
Authors :  R. C. Kelly, P. D. Jeffrey, F. M. Hughson
Date :  05 Nov 09  (Deposition) - 24 Nov 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Quorum Sensing, Vibrio Cholerae, Cqsa, Cai-1, Autoinducer, Plp, Virulence, Acyltransferase, Aminotransferase, Pyridoxal Phosphate, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. C. Kelly, M. E. Bolitho, D. A. Higgins, W. Lu, W. L. Ng, P. D. Jeffrey, J. D. Rabinowitz, M. F. Semmelhack, F. M. Hughson, B. L. Bassler
The Vibrio Cholerae Quorum-Sensing Autoinducer Cai-1: Analysis Of The Biosynthetic Enzyme Cqsa.
Nat. Chem. Biol. V. 5 891 2009
PubMed-ID: 19838203  |  Reference-DOI: 10.1038/NCHEMBIO.237

(-) Compounds

Molecule 1 - CAI-1 AUTOINDUCER SYNTHASE
    Chains: A, B
    EC Number: 2.3.-.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: CQSA, VC_A0523
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666
    Synonym: CHOLERAE QUORUM-SENSING AUTOINDUCER

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric/Biological Unit (4, 8)
No.NameCountTypeFull Name
1DTT2Ligand/Ion2,3-DIHYDROXY-1,4-DITHIOBUTANE
2MG2Ligand/IonMAGNESIUM ION
3PLP2Ligand/IonPYRIDOXAL-5'-PHOSPHATE
4SO42Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:107 , GLY A:108 , TRP A:109 , HIS A:133 , ASP A:173 , ASP A:202 , SER A:204 , HIS A:205 , SER A:233 , LYS A:236 , ALA A:242 , MG A:391 , HOH A:461 , HOH A:508 , PHE B:264 , SER B:265 , SER B:266BINDING SITE FOR RESIDUE PLP A 390
2AC2SOFTWAREARG A:358 , PLP A:390 , HOH A:449BINDING SITE FOR RESIDUE MG A 391
3AC3SOFTWARESER A:107 , GLY A:108 , TRP A:109 , SER A:233 , LYS A:236 , HOH A:508 , SER B:265 , SER B:266BINDING SITE FOR RESIDUE SO4 A 392
4AC4SOFTWAREVAL A:32 , VAL A:344 , PHE A:345 , CYS A:346 , ARG A:347 , PRO A:348 , ALA A:349 , PHE B:257 , ILE B:263 , HOH B:546BINDING SITE FOR RESIDUE DTT A 501
5AC5SOFTWARESER A:265 , SER A:266 , SER B:107 , GLY B:108 , TRP B:109 , SER B:233 , HOH B:508BINDING SITE FOR RESIDUE SO4 B 393
6AC6SOFTWAREPHE A:264 , SER A:265 , SER A:266 , SER B:107 , GLY B:108 , TRP B:109 , HIS B:133 , ASP B:173 , ASP B:202 , SER B:204 , HIS B:205 , SER B:233 , LYS B:236 , ALA B:242 , MG B:391 , HOH B:476 , HOH B:508BINDING SITE FOR RESIDUE PLP B 390
7AC7SOFTWAREHIS B:205 , ARG B:358 , PLP B:390BINDING SITE FOR RESIDUE MG B 391
8AC8SOFTWAREPHE A:257 , ILE A:263 , VAL B:32 , VAL B:344 , PHE B:345 , CYS B:346 , ARG B:347BINDING SITE FOR RESIDUE DTT B 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3KKI)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Arg A:347 -Pro A:348
2Arg B:347 -Pro B:348

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3KKI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3KKI)

(-) Exons   (0, 0)

(no "Exon" information available for 3KKI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:386
 aligned with CQSA_VIBCH | Q9KM65 from UniProtKB/Swiss-Prot  Length:389

    Alignment length:386
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383      
           CQSA_VIBCH     4 PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 389
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh...................ee...........hhhhhhhhhhhhhh.......hhhhhh.....hhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhh....eeeee...hhhhhhhhhhh..eeeee...hhhhhhhhhhhhh..eeeee..........hhhhhhhhhhhhh.eeeee........hhhhhhhhhhh.hhhhh.eeeee.........eeeee..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeeeehhhhhhhhhhhhhhh.ee.eee.........eeeeee.....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kki A   4 PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 389
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383      


Chain B from PDB  Type:PROTEIN  Length:386
 aligned with CQSA_VIBCH | Q9KM65 from UniProtKB/Swiss-Prot  Length:389

    Alignment length:386
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383      
           CQSA_VIBCH     4 PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 389
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------Aminotran_1_2-3kkiB01 B:39-376                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------Aminotran_1_2-3kkiB02 B:39-376                                                                                                                                                                                                                                                                                                                    ------------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhh...................ee...........hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhh....eeeee...hhhhhhhhhhh..eeeee...hhhhhhhhhhhhh..eeeee..........hhhhhhhhhhhhh.eeeee........hhhhhhhhhhh.hhhhh.eeeee.........eeeee..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeeeeeehhhhhhhhhhhhhhh.ee.eee.........eeeeee.....hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kki B   4 PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 389
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3KKI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3KKI)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: PLP_aminotran (240)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CQSA_VIBCH | Q9KM65)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0008483    transaminase activity    Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0008150    biological_process    A biological process represents a specific objective that the organism is genetically programmed to achieve. Biological processes are often described by their outcome or ending state, e.g., the biological process of cell division results in the creation of two daughter cells (a divided cell) from a single parent cell. A biological process is accomplished by a particular set of molecular functions carried out by specific gene products (or macromolecular complexes), often in a highly regulated manner and in a particular temporal sequence.
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DTT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:347 - Pro A:348   [ RasMol ]  
    Arg B:347 - Pro B:348   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3kki
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CQSA_VIBCH | Q9KM65
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.-.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CQSA_VIBCH | Q9KM65
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CQSA_VIBCH | Q9KM65: 2wk7 2wk8 2wk9 2wka 3hqt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3KKI)