Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PHENAZINE ANTIBIOTIC BIOSYNTHESIS PROTEIN
 
Authors :  A. K. Bera, V. Atanasova, J. F. Parsons
Date :  14 May 09  (Deposition) - 28 Apr 10  (Release) - 28 Apr 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Phenazine, Antibiotic, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. K. Bera, V. Atanasova, J. F. Parsons
Structure Of Phenazine Antibiotic Biosynthesis Protein
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - EHPF
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: EHPF
    Organism Common: ERWINIA HERBICOLA
    Organism Scientific: PANTOEA AGGLOMERANS
    Organism Taxid: 549

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 14)

Asymmetric/Biological Unit (1, 14)
No.NameCountTypeFull Name
1MSE14Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3HGV)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HGV)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Thr A:100 -Gly A:101
2Ser A:289 -Pro A:290
3Gly B:97 -Gly B:98
4Ser B:289 -Pro B:290

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HGV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3HGV)

(-) Exons   (0, 0)

(no "Exon" information available for 3HGV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:346
 aligned with Q8GPH0_ENTAG | Q8GPH0 from UniProtKB/TrEMBL  Length:366

    Alignment length:353
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351   
         Q8GPH0_ENTAG     2 KDYSLEIDAVMKAAQINDTNNFVQALMRWHFSKETGSPFWLGMREQLNFDPIKDVKTINDLRQFSDISHCLRQEPVANLVPQGLPADSHPQVYESGGTTGAPKYVVAYDAWIEALISWRMSGYQHRPGRPSGNTLAAIPTGPHIVGAINKERALRLGGMFFSIDIDPRWVKRSLSEGDTATVRKYTHHLVDQVQNTLMNQDIRFLVTTPPVLRELLKRPEVVLQMKQSLAQITLGGTELNLDEIKFIASEILPDCEFSASYGSTSALGVSRSLLITSESQQVIYDSFSPFITYDVVDSITAQTVEYGERGNVIVTHLSPWAFYPRVAERDTAIRLPGVSGFAGDRLADIEPLK 354
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhh..........hhhhhhh..hhhhhhh.hhhhhh.........eeeeee.......eeeeeehhhhhhhhhhhh.-------....eeee......hhhhhhhhhhhhhh...eee...hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.eeeeeehhhhhhhhh.hhhhhhhhhhhh.eeeee....hhhhhhhhhhhh....eeeeeeeehhhheeeee..........eee.....eeeeee............eeeeeeeee....eeeeeeeeeeeeee.........eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hgv A   2 KDYSLEIDAVmKAAQINDTNNFVQALmRWHFSKETGSPFWLGmREQLNFDPIKDVKTINDLRQFSDISHCLRQEPVANLVPQGLPADSHPQVYESGGTTGAPKYVVAYDAWIEALISWRmS-------RPSGNTLAAIPTGPHIVGAINKERALRLGGmFFSIDIDPRWVKRSLSEGDTATVRKYTHHLVDQVQNTLmNQDIRFLVTTPPVLRELLKRPEVVLQmKQSLAQITLGGTELNLDEIKFIASEILPDCEFSASYGSTSALGVSRSLLITSESQQVIYDSFSPFITYDVVDSITAQTVEYGERGNVIVTHLSPWAFYPRVAERDTAIRLPGVSGFAGDRLADIEPLK 354
                                    11|       21      | 31        41  |     51        61        71        81        91       101       111       121|      131       141       151       161       171       181       191       201       211       221    |  231       241       251       261       271       281       291       301       311       321       331       341       351   
                                     12-MSE          28-MSE          44-MSE                                                                      121-MSE  130                           160-MSE                                199-MSE                    226-MSE                                                                                                                            
                                                                                                                                                  122                                                                                                                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:345
 aligned with Q8GPH0_ENTAG | Q8GPH0 from UniProtKB/TrEMBL  Length:366

    Alignment length:352
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352  
         Q8GPH0_ENTAG     3 DYSLEIDAVMKAAQINDTNNFVQALMRWHFSKETGSPFWLGMREQLNFDPIKDVKTINDLRQFSDISHCLRQEPVANLVPQGLPADSHPQVYESGGTTGAPKYVVAYDAWIEALISWRMSGYQHRPGRPSGNTLAAIPTGPHIVGAINKERALRLGGMFFSIDIDPRWVKRSLSEGDTATVRKYTHHLVDQVQNTLMNQDIRFLVTTPPVLRELLKRPEVVLQMKQSLAQITLGGTELNLDEIKFIASEILPDCEFSASYGSTSALGVSRSLLITSESQQVIYDSFSPFITYDVVDSITAQTVEYGERGNVIVTHLSPWAFYPRVAERDTAIRLPGVSGFAGDRLADIEPLK 354
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhh..........hhhhhhh..hhhhhh..hhhhhh..........eeeee.......eeeeehhhhhhhhhhhhhh-------....eeee......hhhhhhhhhhhhhh...eee...hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.eeeeeehhhhhhhhh.hhhhhhhhhhhh.eeeee....hhhhhhhhhhhh....eeeeeeeehhhheeeee..........eee.....eeeeee............eeeeeeeee....eeeeeeeeeeeeee.........eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hgv B   3 DYSLEIDAVmKAAQINDTNNFVQALmRWHFSKETGSPFWLGmREQLNFDPIKDVKTINDLRQFSDISHCLRQEPVANLVPQGLPADSHPQVYESGGTTGAPKYVVAYDAWIEALISWRmS-------RPSGNTLAAIPTGPHIVGAINKERALRLGGmFFSIDIDPRWVKRSLSEGDTATVRKYTHHLVDQVQNTLmNQDIRFLVTTPPVLRELLKRPEVVLQmKQSLAQITLGGTELNLDEIKFIASEILPDCEFSASYGSTSALGVSRSLLITSESQQVIYDSFSPFITYDVVDSITAQTVEYGERGNVIVTHLSPWAFYPRVAERDTAIRLPGVSGFAGDRLADIEPLK 354
                                    12        22     |  32        42 |      52        62        72        82        92       102       112       122       132       142       152       162       172       182       192      |202       212       222   |   232       242       252       262       272       282       292       302       312       322       332       342       352  
                                    12-MSE          28-MSE          44-MSE                                                                      121-MSE  130                           160-MSE                                199-MSE                    226-MSE                                                                                                                            
                                                                                                                                                 122
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3HGV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3HGV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HGV)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8GPH0_ENTAG | Q8GPH0)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3hgv)
 
  Cis Peptide Bonds
    Gly B:97 - Gly B:98   [ RasMol ]  
    Ser A:289 - Pro A:290   [ RasMol ]  
    Ser B:289 - Pro B:290   [ RasMol ]  
    Thr A:100 - Gly A:101   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hgv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8GPH0_ENTAG | Q8GPH0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8GPH0_ENTAG | Q8GPH0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8GPH0_ENTAG | Q8GPH0: 3hgu 3l2k

(-) Related Entries Specified in the PDB File

3hgu