Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL OF AVRPTOB 121-205
 
Authors :  J. Dong, F. Xiao, F. Fan, L. Gu, H. Cang, G. B. Martin, J. Chai
Date :  14 May 09  (Deposition) - 23 Jun 09  (Release) - 18 Aug 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Five Helices, Hypersensitive Response Elicitation, Ligase, Secreted, Ubl Conjugation, Ubl Conjugation Pathway, Virulence (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Dong, F. Xiao, F. Fan, L. Gu, H. Cang, G. B. Martin, J. Chai
Crystal Structure Of The Complex Between Pseudomonas Effector Avrptob And The Tomato Pto Kinase Reveals Both A Shared And A Unique Interface Compared With Avrpto-Pto
Plant Cell V. 21 1846 2009
PubMed-ID: 19509331  |  Reference-DOI: 10.1105/TPC.109.066878
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EFFECTOR PROTEIN HOPAB2
    ChainsA
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-6P-1
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 121-205
    GeneHOPAB2, AVRPTOB, PSPTO_3087
    Organism ScientificPSEUDOMONAS SYRINGAE PV. TOMATO
    Organism Taxid323
    SynonymAVRPTOB, AVIRULENCE PROTEIN AVRPTOB, E3 UBIQUITIN- PROTEIN LIGASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3HGL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HGL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3HGL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HGL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3HGL)

(-) Exons   (0, 0)

(no "Exon" information available for 3HGL)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:78
 aligned with HPAB2_PSESM | Q8RSY1 from UniProtKB/Swiss-Prot  Length:553

    Alignment length:78
                                   133       143       153       163       173       183       193        
          HPAB2_PSESM   124 GAVAHANSIVQQLVSEGADISHTRNMLRNAMNGDAVAFSRVEQNIFRQHFPNMPMHGISRDSELAIELRGALRRAVHQ 201
               SCOP domains ------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhhh.hhhhhh....hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------ Transcript
                 3hgl A   1 GAVAHANSIVQQLVSEGADISHTRNmLRNAmNGDAVAFSRVEQNIFRQHFPNmPmHGISRDSELAIELRGALRRAVHQ  78
                                    10        20     |  30|       40        50  | |   60        70        
                                                    26-MSE|                    53-MSE                     
                                                         31-MSE                  55-MSE                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3HGL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3HGL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HGL)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (HPAB2_PSESM | Q8RSY1)
molecular function
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0052018    modulation by symbiont of RNA levels in host    The alteration by an organism of the levels of RNA in the host organism. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0034053    modulation by symbiont of host defense-related programmed cell death    Any process in which an organism modulates the frequency, rate or extent of defense-related programmed cell death in the host organism. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3hgl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hgl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hgl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HPAB2_PSESM | Q8RSY1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HPAB2_PSESM | Q8RSY1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HPAB2_PSESM | Q8RSY12fd4 3hgk 3tl8

(-) Related Entries Specified in the PDB File

3hgk STRUCTURE OF AVRPTOB (RESIDUES 121-205) BY ITSELF