|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)
Asymmetric Unit (3, 7)
|
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3HCZ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3HCZ) |
Exons (0, 0)| (no "Exon" information available for 3HCZ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:147 aligned with Q11YT9_CYTH3 | Q11YT9 from UniProtKB/TrEMBL Length:474 Alignment length:147 337 347 357 367 377 387 397 407 417 427 437 447 457 467 Q11YT9_CYTH3 328 LDPLLLGKKAPNLYMTDTTGTYRYLYDVQAKYTILFFWDSQCGHCQQETPKLYDWWLKNRAKGIQVYAANIERKDEEWLKFIRSKKIGGWLNVRDSKNHTDFKITYDIYATPVLYVLDKNKVIIAKRIGYENLDDFLVQYEKSLKTK 474 SCOP domains d3hcza_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3hcz A 328 NAPLLLGKKAPNLYmTDTTGTYRYLYDVQAKYTILFFWDSQCGHCQQETPKLYDWWLKNRAKGIQVYAANIERKDEEWLKFIRSKKIGGWLNVRDSKNHTDFKITYDIYATPVLYVLDKNKVIIAKRIGYENLDDFLVQYEKSLKTK 474 337 | 347 357 367 377 387 397 407 417 427 437 447 457 467 342-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3HCZ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3HCZ) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (Q11YT9_CYTH3 | Q11YT9)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|