Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF E. COLI ADIC
 
Authors :  X. Gao, F. Lu, L. Zhou, Y. Shi
Date :  10 Feb 10  (Deposition) - 23 Feb 10  (Release) - 23 Feb 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.61
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transporter, Antiporter, Adic, Amino-Acid Transport, Antiport, Cell Inner Membrane, Cell Membrane, Membrane, Transmembrane, Transport, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. Gao, F. Lu, L. Zhou, S. Dang, L. Sun, X. Li, J. Wang, Y. Shi
Structure And Mechanism Of An Amino Acid Antiporter
Science V. 324 1565 2009
PubMed-ID: 19478139  |  Reference-DOI: 10.1126/SCIENCE.1173654

(-) Compounds

Molecule 1 - ARGININE/AGMATINE ANTIPORTER
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneADIC, Z5717, ECS5097
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83334

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3LRB)

(-) Sites  (0, 0)

(no "Site" information available for 3LRB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LRB)

(-) Cis Peptide Bonds  (32, 32)

Asymmetric/Biological Unit
No.Residues
1Met A:24 -Gly A:25
2Thr A:38 -Gly A:39
3Ile A:41 -Ala A:42
4Pro A:68 -Ser A:69
5Ser A:69 -Pro A:70
6Gly A:71 -Gly A:72
7Phe A:81 -Gly A:82
8Ile A:118 -Leu A:119
9Gly A:143 -Pro A:144
10Phe A:173 -Arg A:174
11Arg A:174 -Gly A:175
12Phe A:310 -Pro A:311
13Pro A:312 -Ile A:313
14Phe A:314 -Ala A:315
15Ala A:315 -Arg A:316
16Ile A:342 -Ser A:343
17Met B:24 -Gly B:25
18Thr B:38 -Gly B:39
19Ile B:41 -Ala B:42
20Pro B:68 -Ser B:69
21Ser B:69 -Pro B:70
22Gly B:71 -Gly B:72
23Phe B:81 -Gly B:82
24Ile B:118 -Leu B:119
25Gly B:143 -Pro B:144
26Phe B:173 -Arg B:174
27Arg B:174 -Gly B:175
28Phe B:310 -Pro B:311
29Pro B:312 -Ile B:313
30Phe B:314 -Ala B:315
31Ala B:315 -Arg B:316
32Ile B:342 -Ser B:343

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LRB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LRB)

(-) Exons   (0, 0)

(no "Exon" information available for 3LRB)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:410
 aligned with ADIC_ECO57 | P60063 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:430
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435
           ADIC_ECO57     6 DAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNP 435
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhh.....hhhhhh.......hhhhhhhhhhhhhhhhhhhhhh..........hhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh.....hhhhhhhhhh..........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.........--------------------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lrb A   6 DAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPN--------------------TAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNP 435
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245      |  -         -       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435
                                                                                                                                                                                                                                                                                252                  273                                                                                                                                                                  

Chain B from PDB  Type:PROTEIN  Length:410
 aligned with ADIC_ECO57 | P60063 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:430
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435
           ADIC_ECO57     6 DAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNP 435
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----AA_permease_2-3lrbB01 B:10-428                                                                                                                                                                                                                                                                                                                                                                                                     ------- Pfam domains (1)
           Pfam domains (2) ----AA_permease_2-3lrbB02 B:10-428                                                                                                                                                                                                                                                                                                                                                                                                     ------- Pfam domains (2)
         Sec.struct. author .....hhhhhhhhhhhhhh.....hhhhhh.......hhhhhhhhhhhhhhhhhhhhhh..........hhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh.....hhhhhhhhhh..........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.........--------------------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3lrb B   6 DAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPN--------------------TAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNP 435
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245      |  -         -       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435
                                                                                                                                                                                                                                                                                252                  273                                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3LRB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LRB)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: APC (6)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ADIC_ECO57 | P60063)
molecular function
    GO:0015171    amino acid transmembrane transporter activity    Enables the transfer of amino acids from one side of a membrane to the other. Amino acids are organic molecules that contain an amino group and a carboxyl group.
    GO:0015297    antiporter activity    Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported in opposite directions in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy. The reaction is: solute A(out) + solute B(in) = solute A(in) + solute B(out).
biological process
    GO:0003333    amino acid transmembrane transport    The process in which an amino acid is transported across a membrane.
    GO:0006865    amino acid transport    The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3lrb)
 
  Sites
(no "Sites" information available for 3lrb)
 
  Cis Peptide Bonds
    Ala A:315 - Arg A:316   [ RasMol ]  
    Ala B:315 - Arg B:316   [ RasMol ]  
    Arg A:174 - Gly A:175   [ RasMol ]  
    Arg B:174 - Gly B:175   [ RasMol ]  
    Gly A:143 - Pro A:144   [ RasMol ]  
    Gly A:71 - Gly A:72   [ RasMol ]  
    Gly B:143 - Pro B:144   [ RasMol ]  
    Gly B:71 - Gly B:72   [ RasMol ]  
    Ile A:118 - Leu A:119   [ RasMol ]  
    Ile A:342 - Ser A:343   [ RasMol ]  
    Ile A:41 - Ala A:42   [ RasMol ]  
    Ile B:118 - Leu B:119   [ RasMol ]  
    Ile B:342 - Ser B:343   [ RasMol ]  
    Ile B:41 - Ala B:42   [ RasMol ]  
    Met A:24 - Gly A:25   [ RasMol ]  
    Met B:24 - Gly B:25   [ RasMol ]  
    Phe A:173 - Arg A:174   [ RasMol ]  
    Phe A:310 - Pro A:311   [ RasMol ]  
    Phe A:314 - Ala A:315   [ RasMol ]  
    Phe A:81 - Gly A:82   [ RasMol ]  
    Phe B:173 - Arg B:174   [ RasMol ]  
    Phe B:310 - Pro B:311   [ RasMol ]  
    Phe B:314 - Ala B:315   [ RasMol ]  
    Phe B:81 - Gly B:82   [ RasMol ]  
    Pro A:312 - Ile A:313   [ RasMol ]  
    Pro A:68 - Ser A:69   [ RasMol ]  
    Pro B:312 - Ile B:313   [ RasMol ]  
    Pro B:68 - Ser B:69   [ RasMol ]  
    Ser A:69 - Pro A:70   [ RasMol ]  
    Ser B:69 - Pro B:70   [ RasMol ]  
    Thr A:38 - Gly A:39   [ RasMol ]  
    Thr B:38 - Gly B:39   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lrb
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ADIC_ECO57 | P60063
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ADIC_ECO57 | P60063
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ADIC_ECO57 | P600633l1l 3lrc 5j4i 5j4n

(-) Related Entries Specified in the PDB File

3lrc