Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF YQEH GTPASE FROM BACILLUS ANTHRACIS WITH DGDP BOUND
 
Authors :  J. S. Brunzelle, S. M. Anderson, X. Xu, A. Savchenko, W. F. Anderson, Cen Structural Genomics Of Infectious Diseases (Csgid)
Date :  15 Apr 09  (Deposition) - 16 Jun 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Gtp-Binding Protein Yqeh, Possibly Involved In Replication Initiation, Csgid, Idp90222, Center For Structural Genomics Of Infectious Diseases, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. S. Brunzelle, S. M. Anderson, Z. Wawrzak, U. Xu, H. Cui, A. Savchenko W. F. Anderson
Structure Of Yqeh Gtpase From Bacillus Anthracis With Dgdp Bound
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GTPASE FAMILY PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG7
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: BAS4233, BA_4562, GBAA4562, GBAA_4562, YQEH
    Organism Scientific: BACILLUS ANTHRACIS STR.
    Organism Taxid: 260799
    Strain: STERNE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
1DGI1Ligand/Ion2'-DEOXYGUANOSINE-5'-DIPHOSPHATE
2MSE5Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:104 , LYS A:105 , ASP A:107 , LEU A:108 , SER A:140 , ALA A:141 , ALA A:142 , CYS A:168 , THR A:169 , ASN A:170 , VAL A:171 , GLY A:172 , LYS A:173 , SER A:174 , THR A:175 , HIS A:196 , HOH A:372 , HOH A:375 , HOH A:417 , HOH A:427 , HOH A:437BINDING SITE FOR RESIDUE DGI A 369

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3H2Y)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ser A:307 -Pro A:308
2Pro A:308 -Pro A:309

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3H2Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3H2Y)

(-) Exons   (0, 0)

(no "Exon" information available for 3H2Y)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:309
 aligned with Q81LQ0_BACAN | Q81LQ0 from UniProtKB/TrEMBL  Length:368

    Alignment length:313
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365   
         Q81LQ0_BACAN    56 DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWMRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRMIKEFSDETENVITTSHFPGTTLDLIDIPLDEESSLYDTPGIINHHQMAHYVGKQSLKLITPTKEIKPMVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENMPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI 368
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh..eeeeeee..hhhhhh..hhhhhh....eeeeeehhhhh....hhhhhhhhhhhhhhhh.....eeee.......hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhh.......eee...----.eeeee.....eeee........hhhhhhhhhhhhhhh.......eeeee...eeeee...eeeeeee...eeeeeee.....eeeeehhhhhhhhhhhh.......hhhhhhh...eeeeeee.....eeeee...eeeee.....eeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3h2y A  56 DDDFLRILNGIGKSDALVVKIVDIFDFNGSWLPGLHRFVGNNKVLLVGNKADLIPKSVKHDKVKHWmRYSAKQLGLKPEDVFLISAAKGQGIAELADAIEYYRGGKDVYVVGCTNVGKSTFINRmIKEFSDETENVITTSHFP----DLIDIPLDEESSLYDTPGIINHHQmAHYVGKQSLKLITPTKEIKPmVFQLNEEQTLFFSGLARFDYVSGGRRAFTCHFSNRLTIHRTKLEKADELYKNHAGDLLSPPTPEELENmPELVKYEFNIREPKTDVVFSGLGWVTVNEPGAKIVAHVPKGVSVSLRKSLI 368
                                    65        75        85        95       105       115      |125       135       145       155       165       175    |  185       195  |    205       215       225 |     235       245  |    255       265       275       285       295       305       315 |     325       335       345       355       365   
                                                                                            122-MSE                                                   180-MSE           198  203                     227-MSE              248-MSE                                                              317-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3H2Y)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3H2Y)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3H2Y)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q81LQ0_BACAN | Q81LQ0)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DGI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:308 - Pro A:309   [ RasMol ]  
    Ser A:307 - Pro A:308   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3h2y
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81LQ0_BACAN | Q81LQ0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81LQ0_BACAN | Q81LQ0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3H2Y)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3H2Y)