|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (5, 18) |
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 3FYB) |
(no "Cis Peptide Bond" information available for 3FYB) |
(no "SAP(SNP)/Variant" information available for 3FYB) |
(no "PROSITE Motif" information available for 3FYB) |
(no "Exon" information available for 3FYB) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:98 aligned with Q0VSW0_ALCBS | Q0VSW0 from UniProtKB/TrEMBL Length:103 Alignment length:98 1 | 9 19 29 39 49 59 69 79 89 Q0VSW0_ALCBS - -MADIDQASKTEMEAAAFRHLLRHLDEHKDVQNIDLMIQADFCRNCLAKWLMEAATEQGVELDYDGAREYVYGMPFAEWKTLYQKPASEAQLAAFEAK 97 SCOP domains d3fyba_ A: automated matches SCOP domains CATH domains 3fybA00 A:0-97 SMc04008-like domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------- Transcript 3fyb A 0 GmADIDQASKTEmEAAAFRHLLRHLDEHKDVQNIDLmIQADFCRNCLAKWLmEAATEQGVELDYDGAREYVYGmPFAEWKTLYQKPASEAQLAAFEAK 97 | 9 | 19 29 | 39 49 | 59 69 | 79 89 | 12-MSE 36-MSE 51-MSE 73-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:88 aligned with Q0VSW0_ALCBS | Q0VSW0 from UniProtKB/TrEMBL Length:103 Alignment length:88 1 | 9 19 29 39 49 59 69 79 Q0VSW0_ALCBS - -MADIDQASKTEMEAAAFRHLLRHLDEHKDVQNIDLMIQADFCRNCLAKWLMEAATEQGVELDYDGAREYVYGMPFAEWKTLYQKPAS 87 SCOP domains d3fybb_ B: automated matches SCOP domains CATH domains 3fybB00 B:0-87 SMc04008-like domain CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 3fyb B 0 GmADIDQASKTEmEAAAFRHLLRHLDEHKDVQNIDLmIQADFCRNCLAKWLmEAATEQGVELDYDGAREYVYGmPFAEWKTLYQKPAS 87 | 9 | 19 29 | 39 49 | 59 69 | 79 1-MSE 12-MSE 36-MSE 51-MSE 73-MSE
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
(no "Pfam Domain" information available for 3FYB) |
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3FYB)
|
|
|
|
|
|
|