|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 5)
Asymmetric/Biological Unit (1, 5)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3F52) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3F52) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3F52) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3F52) |
Exons (0, 0)| (no "Exon" information available for 3F52) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:77 aligned with Q8NP59_CORGL | Q8NP59 from UniProtKB/TrEMBL Length:107 Alignment length:77 31 41 51 61 71 81 91 Q8NP59_CORGL 22 EPLLREALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKEVSSELLASVCHALGASVADVLIEAAGSMALQ 98 SCOP domains ----------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------- Transcript 3f52 A 22 EPLLREALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKEVSSELLASVCHALGASVADVLIEAAGSMALQ 98 31 41 51 61 71 81 91 Chain E from PDB Type:PROTEIN Length:78 aligned with Q8NP59_CORGL | Q8NP59 from UniProtKB/TrEMBL Length:107 Alignment length:78 28 38 48 58 68 78 88 Q8NP59_CORGL 19 KAPEPLLREALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKEVSSELLASVCHALGASVADVLIEAAGSMA 96 SCOP domains ------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 3f52 E 19 KAPEPLLREALGAALRSFRADKGVTLRELAEASRVSPGYLSELERGRKEVSSELLASVCHALGASVADVLIEAAGSMA 96 28 38 48 58 68 78 88
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3F52) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3F52) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3F52) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,E (Q8NP59_CORGL | Q8NP59)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|