|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric/Biological Unit (3, 4) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3EXN) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3EXN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3EXN) |
Exons (0, 0)| (no "Exon" information available for 3EXN) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:154 aligned with Q5SLW7_THET8 | Q5SLW7 from UniProtKB/TrEMBL Length:157 Alignment length:154 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 Q5SLW7_THET8 4 MHVLTLDLAPVTPKDAPLLHRVFHLSPSYFALIGMELPTLEDVVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLGYPEAEDATLSLLLIREDHQGRGLGRQALERFAAGLDGVRRLYAVVYGHNPKAKAFFQAQGFRYVKDGGPTLTWYVRPL 157 SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -3exnA00 A:5-157 [code=3.40.630.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3exn A 4 mHVLTLDLAPVTPKDAPLLHRVFHLSPSYFALIGmELPTLEDVVRDLQTLEVDPRRRAFLLFLGQEPVGYLDAKLGYPEAEDATLSLLLIREDHQGRGLGRQALERFAAGLDGVRRLYAVVYGHNPKAKAFFQAQGFRYVKDGGPTLTWYVRPL 157 | 13 23 33 | 43 53 63 73 83 93 103 113 123 133 143 153 | 38-MSE 4-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3EXN) |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3EXN) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q5SLW7_THET8 | Q5SLW7)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|