Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE C-TERMINAL PHOSPHATASE DOMAIN OF P. AERUGINONSA RSSB
 
Authors :  I Levchenko, R. A. Grant, R. T. Sauer, T. A. Baker
Date :  03 Oct 08  (Deposition) - 20 Oct 09  (Release) - 20 Oct 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.95
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Adaptor Phosphatase, Unknown Function, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I Levchenko, R. A. Grant, R. T. Sauer, T. A. Baker
The Structure Of Rssb, A Clpx Adaptor Protein That Regulates Sigma S
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 140-394, C-TERMINAL PHOSPHATASE DOMAIN
    Gene: PA2798
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 287

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 11)

Asymmetric/Biological Unit (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3ES2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ES2)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Thr A:170 -Pro A:171
2Thr B:170 -Pro B:171

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3ES2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3ES2)

(-) Exons   (0, 0)

(no "Exon" information available for 3ES2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:225
 aligned with Q9I045_PSEAE | Q9I045 from UniProtKB/TrEMBL  Length:394

    Alignment length:248
                                   154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384        
         Q9I045_PSEAE   145 LQASLNLLQEDQNAGRQVQMNMLPVTPWSIEGLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYESRRNGTLPEFKPSEVLAHINRGLINTKLGKHVTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQAGYLEGRGLPVGLFDDATYDDRVMELPPSFSLSLFSDGILDVLPGATLKEKEASLPEQVAAAGGTLDGLRQVFGLANLAEMPDDIALLVLSRN 392
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh......eee..eeeeeeee.......eeee..ee...eeeeeeeee...hhhhhhhhhhhhhhhhhhhhhh..------..hhhhhhhhhhhhhh......eeeeeeeee....eeeeee.......ee............---..........eeeee...--.eee........--...hhhhhhhhhhhhhhhh..hhhhhhh----------..eeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3es2 A 145 LQASLNLLQEDQNAGRQVQmNmLPVTPWSIEGLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFmTTRLLYESRR------FKPSEVLAHINRGLINTKLGKHVTmLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQAGYLEGR---VGLFDDATYDDRVmELPP--SLSLFSDGILDV--GATLKEKEASLPEQVAAAGGTLDGLRQV----------DDIALLVLSRN 392
                                   154       164 |     174       184       194       204       214       224   |   234   |     -|      254       264    |  274       284       294       304 |   | 314       324  |  | 334      |344       354       364      |  -       384        
                                             164-MSE                                                         228-MSE   238    245                     269-MSE                              306 310          323-MSE  |        341  |                        371        382          
                                               166-MSE                                                                                                                                                             330           344                                                


Chain B from PDB  Type:PROTEIN  Length:214
 aligned with Q9I045_PSEAE | Q9I045 from UniProtKB/TrEMBL  Length:394

    Alignment length:247
                                   153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       
         Q9I045_PSEAE   144 ELQASLNLLQEDQNAGRQVQMNMLPVTPWSIEGLEFSHRIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFVTVLLKFMTTRLLYESRRNGTLPEFKPSEVLAHINRGLINTKLGKHVTMLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQAGYLEGRGLPVGLFDDATYDDRVMELPPSFSLSLFSDGILDVLPGATLKEKEASLPEQVAAAGGTLDGLRQVFGLANLAEMPDDIALLVLS 390
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhh......eee..eeeeeeee........eee.....---.eeeeeee...hhhhhhhhhhhhhhhhhhhhh--------..hhhhhhhhhhhhhhh......eeeeeeeee....eeeeee..............-.............------.eeee......eeee.....--------hhhhhhhhhhhhhhh--hhhhhhhhhh-----....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3es2 B 144 ELQASLNLLQEDQNAGRQVQmNmLPVTPWSIEGLEFSHRIIPSLYLSGDFVDYFRVD---VAFYLADVSGHGASSAFVTVLLKFmTTRLLYE--------EFKPSEVLAHINRGLINTKLGKHVTmLGGVIDLEKNSLTYSIGGHLPLPVLFVEGQ-GYLEGRGLPVGLF------DRVmELPPSFSLSLFSDGIL--------KEKEASLPEQVAAAG--LDGLRQVFGL-----mPDDIALLVLS 390
                                   153       163| |    173       183       193      |  -|      213       223    |  233 |       -|      253       263     | 273       283       293     | 303       313      |323       333     |   -    |  353        |- |     373|     |383       
                                              164-MSE                             200 204                     228-MSE235      244                      269-MSE                       299 |         313    320  |             339      348           362  |      374     |          
                                                166-MSE                                                                                                                                301                   323-MSE                                   365            380-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3ES2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3ES2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ES2)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9I045_PSEAE | Q9I045)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3es2)
 
  Cis Peptide Bonds
    Thr A:170 - Pro A:171   [ RasMol ]  
    Thr B:170 - Pro B:171   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3es2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9I045_PSEAE | Q9I045
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9I045_PSEAE | Q9I045
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9I045_PSEAE | Q9I045: 3eq2 3f79 3f7a

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3ES2)