|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4) Biological Unit 1 (2, 8) Biological Unit 2 (2, 4) |
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 3EPY) |
(no "Cis Peptide Bond" information available for 3EPY) |
(no "SAP(SNP)/Variant" information available for 3EPY) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 3EPY) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:88 aligned with ACBD7_HUMAN | Q8N6N7 from UniProtKB/Swiss-Prot Length:88 Alignment length:88 10 20 30 40 50 60 70 80 ACBD7_HUMAN 1 MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI 88 SCOP domains d3epya_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --ACB_2 PDB: A:3-88 UniProt: 3-88 PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 3epy A 1 MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI 88 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:86 aligned with ACBD7_HUMAN | Q8N6N7 from UniProtKB/Swiss-Prot Length:88 Alignment length:86 12 22 32 42 52 62 72 82 ACBD7_HUMAN 3 LQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI 88 SCOP domains d3epyb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ACB_2 PDB: B:3-88 UniProt: 3-88 PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 3epy B 3 LQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI 88 12 22 32 42 52 62 72 82
|
Asymmetric Unit |
(no "CATH Domain" information available for 3EPY) |
(no "Pfam Domain" information available for 3EPY) |
Asymmetric Unit(hide GO term definitions) Chain A,B (ACBD7_HUMAN | Q8N6N7)
|
|
|
|
|
|
|