|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 3EIP) |
(no "Cis Peptide Bond" information available for 3EIP) |
(no "SAP(SNP)/Variant" information available for 3EIP) |
(no "PROSITE Motif" information available for 3EIP) |
(no "Exon" information available for 3EIP) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:84 aligned with IMM3_ECOLX | P02984 from UniProtKB/Swiss-Prot Length:85 Alignment length:84 11 21 31 41 51 61 71 81 IMM3_ECOLX 2 GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW 85 SCOP domains d3eipa_ A: Colicin E3 immunity protein SCOP domains CATH domains 3eipA00 A:1-84 [code=3.10.50.20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 3eip A 1 GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW 84 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:84 aligned with IMM3_ECOLX | P02984 from UniProtKB/Swiss-Prot Length:85 Alignment length:84 11 21 31 41 51 61 71 81 IMM3_ECOLX 2 GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW 85 SCOP domains d3eipb_ B: Colicin E3 immunity protein SCOP domains CATH domains 3eipB00 B:1-84 [code=3.10.50.20, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 3eip B 1 GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW 84 10 20 30 40 50 60 70 80
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 3EIP) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (IMM3_ECOLX | P02984)
|
|
|
|
|
|
|