|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric Unit (3, 5) Biological Unit 1 (3, 10) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3EC6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3EC6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3EC6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3EC6) |
Exons (0, 0)| (no "Exon" information available for 3EC6) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:129 aligned with Q81Z55_BACAN | Q81Z55 from UniProtKB/TrEMBL Length:138 Alignment length:138 10 20 30 40 50 60 70 80 90 100 110 120 130 Q81Z55_BACAN 1 MHLKEKITTIIQGQRTGVLSTVRNDKPHSAFMMFFHEDFVLYVATDRQSKKITDIENNPNVHVLLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWLLRPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL 138 SCOP domains d3ec6a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript 3ec6 A 1 mHLKEKITTIIQGQRTGVLSTVRNDKPHSAFmmFFHEDFVLYVATDRQSKKITDIENNPNVHVLLGR---KLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWLLRPEDPNYVLIKINPDTIYYID------PEFLRL 138 | 10 20 30 || 40 50 60 | -| 80 90 100 110 120 | - | | 32-MSE 67 71 126 133 1-MSE 33-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3EC6) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3EC6) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (Q81Z55_BACAN | Q81Z55)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|