Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF RACEMIC PLECTASIN
 
Authors :  K. Mandal, B. L. Pentelute, V. Tereshko, A. A. Kossiakoff, S. B. H. Kent
Date :  18 Aug 08  (Deposition) - 09 Jun 09  (Release) - 28 Mar 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.00
Chains :  Asym./Biol. Unit :  L
Keywords :  Plectasin, Racemic Protein Crystallography, Antibiotic, Antimicrobial, Cleavage On Pair Of Basic Residues, Defensin, Secreted, Antimicrobial Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Mandal, B. L. Pentelute, V. Tereshko, V. Thammavongsa, O. Schneewind, A. A. Kossiakoff, S. B. Kent
Racemic Crystallography Of Synthetic Protein Enantiomers Used To Determine The X-Ray Structure Of Plectasin By Direc Methods
Protein Sci. V. 18 1146 2009
PubMed-ID: 19472324  |  Reference-DOI: 10.1002/PRO.127

(-) Compounds

Molecule 1 - PLECTASIN
    ChainsL
    EngineeredYES
    Other DetailsTHE PEPTIDE IS NATURALLY FOUND IN PSEUDOPLECTANIA NIGRELLA (EBONY CUP).
    SyntheticYES

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit L

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3E7R)

(-) Sites  (0, 0)

(no "Site" information available for 3E7R)

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1L:4 -L:30
2L:15 -L:37
3L:19 -L:39

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3E7R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3E7R)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INVERT_DEFENSINSPS51378 Invertebrate defensins family profile.PLECT_PSENR56-95  1L:1-40

(-) Exons   (0, 0)

(no "Exon" information available for 3E7R)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain L from PDB  Type:PROTEIN  Length:40
 aligned with PLECT_PSENR | Q53I06 from UniProtKB/Swiss-Prot  Length:95

    Alignment length:40
                                    65        75        85        95
           PLECT_PSENR   56 GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY 95
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhh....eeeee....eeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE INVERT_DEFENSINS  PDB: L:1-40            PROSITE
                 Transcript ---------------------------------------- Transcript
                  3e7r L  1 GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY 40
                                    10        20        30        40

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3E7R)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3E7R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3E7R)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain L   (PLECT_PSENR | Q53I06)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3e7r)
 
  Sites
(no "Sites" information available for 3e7r)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3e7r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3e7r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLECT_PSENR | Q53I06
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLECT_PSENR | Q53I06
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLECT_PSENR | Q53I061zfu 3e7u

(-) Related Entries Specified in the PDB File

3e7u