Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  H55S MUTANT XANTHOMONAS CAMPESTRIS TRYPTOPHAN 2,3-DIOXYGENASE
 
Authors :  C. G. Mowat, L. P. Campbell
Date :  31 Jul 08  (Deposition) - 30 Sep 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F,G,H  (1x)
Keywords :  Tdo, Heme, Tryptophan 2, 3-Dioxygenase, H55S, Oxidoreductase, Dioxygenase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. J. Thackray, C. Bruckmann, J. L. Anderson, L. P. Campbell, R. Xiao, L. Zhao, C. G. Mowat, F. Forouhar, L. Tong, S. K. Chapman
Histidine 55 Of Tryptophan 2, 3-Dioxygenase Is Not An Active Site Base But Regulates Catalysis By Controlling Substrate Binding
Biochemistry V. 47 10677 2008
PubMed-ID: 18783250  |  Reference-DOI: 10.1021/BI801202A
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRYPTOPHAN 2,3-DIOXYGENASE
    Chains: A, B, C, D, E, F, G, H
    EC Number: 1.13.11.11
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMGK
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: XCCB100_0466
    Mutation: YES
    Organism Scientific: XANTHOMONAS CAMPESTRIS PV. CAMPESTRIS
    Organism Taxid: 340

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): ABCD    
Biological Unit 2 (1x):     EFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 24)

Asymmetric Unit (2, 24)
No.NameCountTypeFull Name
1HEM8Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
2TRP16Mod. Amino AcidTRYPTOPHAN
Biological Unit 1 (2, 12)
No.NameCountTypeFull Name
1HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
2TRP8Mod. Amino AcidTRYPTOPHAN
Biological Unit 2 (2, 12)
No.NameCountTypeFull Name
1HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
2TRP8Mod. Amino AcidTRYPTOPHAN

(-) Sites  (24, 24)

Asymmetric Unit (24, 24)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPHE A:51 , SER A:55 , TYR A:113 , ARG A:117 , SER A:123 , SER A:124 , GLY A:253 , THR A:254 , HEM A:401 , HOH A:405 , TYR B:24BINDING SITE FOR RESIDUE TRP A 402
02AC2SOFTWAREGLN A:54 , SER A:55 , SER A:58 , TRP A:102 , LEU A:105 , SER A:124 , GLY A:125 , PHE A:126 , TYR A:131 , ARG A:132 , HIS A:240 , VAL A:244 , VAL A:247 , GLY A:253 , THR A:254 , GLY A:255 , GLY A:256 , SER A:257 , LEU A:263 , TRP A:402 , HOH A:405 , HOH A:413 , HOH A:434 , ARG B:8BINDING SITE FOR RESIDUE HEM A 401
03AC3SOFTWAREARG A:85 , LYS A:92 , SER A:221 , GLU A:224 , ASP A:225 , ASP A:228 , HOH A:419 , HOH A:435 , HOH A:532 , HOH A:556 , HOH A:669 , LYS C:86BINDING SITE FOR RESIDUE TRP A 403
04AC4SOFTWAREARG A:8 , TYR A:24 , GLN B:54 , SER B:55 , TRP B:102 , LEU B:105 , SER B:124 , GLY B:125 , PHE B:126 , TYR B:131 , ARG B:132 , HIS B:240 , VAL B:244 , VAL B:247 , GLY B:253 , THR B:254 , GLY B:255 , GLY B:256 , SER B:257 , LEU B:263 , TRP B:402 , HOH B:550 , HOH B:555 , HOH B:559BINDING SITE FOR RESIDUE HEM B 401
05AC5SOFTWARETYR A:24 , PHE B:51 , SER B:55 , TYR B:113 , ARG B:117 , SER B:123 , SER B:124 , GLY B:253 , THR B:254 , HEM B:401 , HOH B:550BINDING SITE FOR RESIDUE TRP B 402
06AC6SOFTWAREARG B:85 , LYS B:92 , SER B:221 , ASP B:225 , ASP B:228 , HOH B:554 , HOH B:603 , HOH B:648 , HOH B:654 , LYS D:86BINDING SITE FOR RESIDUE TRP B 403
07AC7SOFTWARELYS A:86 , ALA A:89 , LYS C:92 , SER C:221 , ASP C:228 , HOH C:627 , HOH C:644 , HOH C:655 , HOH C:760 , HOH C:764BINDING SITE FOR RESIDUE TRP C 403
08AC8SOFTWAREPHE C:51 , SER C:55 , TYR C:113 , ARG C:117 , SER C:123 , SER C:124 , GLY C:253 , THR C:254 , HEM C:401 , HOH C:643 , TYR D:24BINDING SITE FOR RESIDUE TRP C 402
09AC9SOFTWAREGLN C:54 , SER C:55 , TRP C:102 , LEU C:105 , SER C:124 , GLY C:125 , PHE C:126 , TYR C:131 , ARG C:132 , HIS C:240 , VAL C:244 , VAL C:247 , GLY C:253 , THR C:254 , GLY C:255 , SER C:257 , LEU C:263 , TRP C:402 , HOH C:643 , HOH C:646 , HOH C:666 , ARG D:8 , TYR D:24BINDING SITE FOR RESIDUE HEM C 401
10BC1SOFTWARELYS B:86 , ARG D:85 , LYS D:92 , SER D:221 , ASP D:225 , ASP D:228 , HOH D:630 , HOH D:657 , HOH D:727 , HOH D:741 , HOH D:823BINDING SITE FOR RESIDUE TRP D 403
11BC2SOFTWARETYR C:24 , PHE D:51 , SER D:55 , TYR D:113 , ARG D:117 , SER D:123 , SER D:124 , GLY D:253 , THR D:254 , HEM D:401 , HOH D:629BINDING SITE FOR RESIDUE TRP D 402
12BC3SOFTWAREARG C:8 , TYR C:24 , GLN D:54 , SER D:55 , TRP D:102 , LEU D:105 , SER D:124 , GLY D:125 , PHE D:126 , TYR D:131 , ARG D:132 , HIS D:240 , VAL D:244 , VAL D:247 , GLY D:253 , THR D:254 , GLY D:255 , GLY D:256 , SER D:257 , LEU D:263 , TRP D:402 , HOH D:629 , HOH D:679 , HOH D:680BINDING SITE FOR RESIDUE HEM D 401
13BC4SOFTWAREPHE E:51 , SER E:55 , TYR E:113 , ARG E:117 , SER E:123 , GLY E:253 , THR E:254 , HEM E:401 , HOH E:408 , TYR F:24BINDING SITE FOR RESIDUE TRP E 402
14BC5SOFTWAREGLN E:54 , SER E:55 , TRP E:102 , LEU E:105 , SER E:124 , GLY E:125 , PHE E:126 , TYR E:131 , ARG E:132 , HIS E:240 , VAL E:244 , VAL E:247 , ILE E:248 , GLY E:253 , GLY E:255 , SER E:257 , TRP E:402 , HOH E:408 , HOH E:427 , HOH E:442 , ARG F:8 , TYR F:24BINDING SITE FOR RESIDUE HEM E 401
15BC6SOFTWAREARG E:85 , LYS E:92 , TYR E:220 , SER E:221 , ASP E:225 , ASP E:228 , HOH E:417 , HOH E:467 , HOH E:512 , LYS G:86BINDING SITE FOR RESIDUE TRP E 403
16BC7SOFTWARETYR E:24 , PHE F:51 , TYR F:113 , ARG F:117 , SER F:123 , SER F:124 , GLY F:253 , THR F:254 , HEM F:401 , HOH F:503BINDING SITE FOR RESIDUE TRP F 402
17BC8SOFTWAREARG E:8 , TYR E:24 , GLN F:54 , SER F:55 , TRP F:102 , LEU F:105 , SER F:124 , GLY F:125 , PHE F:126 , TYR F:131 , ARG F:132 , HIS F:240 , VAL F:244 , VAL F:247 , ILE F:248 , GLY F:253 , GLY F:255 , GLY F:256 , SER F:257 , LEU F:263 , TRP F:402 , HOH F:442 , HOH F:503 , HOH F:529BINDING SITE FOR RESIDUE HEM F 401
18BC9SOFTWARELYS F:92 , SER F:221 , GLU F:224 , ASP F:225 , ASP F:228 , HOH F:468 , HOH F:512 , HOH F:573 , LYS H:86BINDING SITE FOR RESIDUE TRP F 403
19CC1SOFTWARELYS E:86 , ARG G:85 , LYS G:92 , SER G:221 , ASP G:228 , HOH G:457 , HOH G:473 , HOH G:475 , HOH G:477BINDING SITE FOR RESIDUE TRP G 403
20CC2SOFTWAREPHE G:51 , SER G:55 , TYR G:113 , ARG G:117 , SER G:123 , GLY G:253 , THR G:254 , HEM G:401 , HOH G:415 , TYR H:24BINDING SITE FOR RESIDUE TRP G 402
21CC3SOFTWAREGLN G:54 , SER G:55 , TRP G:102 , LEU G:105 , SER G:124 , GLY G:125 , PHE G:126 , TYR G:131 , ARG G:132 , HIS G:240 , VAL G:244 , VAL G:247 , ILE G:248 , GLY G:253 , THR G:254 , GLY G:255 , SER G:257 , LEU G:263 , ALA G:266 , TRP G:402 , HOH G:415 , HOH G:503 , HOH G:523 , ARG H:8 , TYR H:24BINDING SITE FOR RESIDUE HEM G 401
22CC4SOFTWARELYS F:86 , ARG H:85 , LYS H:92 , SER H:221 , GLU H:224 , ASP H:228 , HOH H:675 , HOH H:690 , HOH H:794 , HOH H:795 , HOH H:860BINDING SITE FOR RESIDUE TRP H 403
23CC5SOFTWARETYR G:24 , PHE H:51 , SER H:55 , TYR H:113 , ARG H:117 , LEU H:120 , SER H:123 , SER H:124 , GLY H:253 , THR H:254 , HEM H:401 , HOH H:662BINDING SITE FOR RESIDUE TRP H 402
24CC6SOFTWAREARG G:8 , TYR G:24 , GLN H:54 , SER H:55 , TRP H:102 , SER H:124 , GLY H:125 , PHE H:126 , TYR H:131 , ARG H:132 , HIS H:240 , VAL H:244 , VAL H:247 , ILE H:248 , GLY H:253 , GLY H:255 , SER H:257 , GLY H:259 , LEU H:263 , TRP H:402 , HOH H:662 , HOH H:710 , HOH H:763BINDING SITE FOR RESIDUE HEM H 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3E08)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Glu A:42 -Pro A:43
2Glu B:42 -Pro B:43
3Glu C:42 -Pro C:43
4Glu D:42 -Pro D:43
5Glu E:42 -Pro E:43
6Glu F:42 -Pro F:43
7Glu G:42 -Pro G:43
8Glu H:42 -Pro H:43

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3E08)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3E08)

(-) Exons   (0, 0)

(no "Exon" information available for 3E08)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:282
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:285
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286     
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDNRPPQG 291
               SCOP domains d3e08a_ A: automated matches                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh...hhhhhhhhhh.....---.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e08 A   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDN---WW 403
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286   | 
                                                                                                                                                                                                                                                                                                                 286 402 


Chain B from PDB  Type:PROTEIN  Length:280
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:280
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDN 286
               SCOP domains d3e08b_ B: automated matches                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh...hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e08 B   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDN 286
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286


Chain C from PDB  Type:PROTEIN  Length:282
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:282
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286  
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDNRP 288
               SCOP domains d3e08c_ C: automated matches                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh...hhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3e08 C   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDNWW 402
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286||
                                                                                                                                                                                                                                                                                                                 286||
                                                                                                                                                                                                                                                                                                                  403|
                                                                                                                                                                                                                                                                                                                   402


Chain D from PDB  Type:PROTEIN  Length:282
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:282
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286  
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDNRP 288
               SCOP domains d3e08d_ D: automated matches                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhh...hhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3e08 D   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDNWW 402
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286||
                                                                                                                                                                                                                                                                                                                 286||
                                                                                                                                                                                                                                                                                                                  403|
                                                                                                                                                                                                                                                                                                                   402


Chain E from PDB  Type:PROTEIN  Length:280
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:280
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVDN 286
               SCOP domains d3e08e_ E: automated matches                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhh.....hhhhhh.........hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh...hhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e08 E   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVWW 403
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       403
                                                                                                                                                                                                                                                                                                               284| 
                                                                                                                                                                                                                                                                                                                402 


Chain F from PDB  Type:PROTEIN  Length:278
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:278
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276        
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV 284
               SCOP domains d3e08f_ F: automated matches                                                                                                                                                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh...hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e08 F   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVWW 403
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276     || 
                                                                                                                                                                                                                                                                                                             282| 
                                                                                                                                                                                                                                                                                                              402 


Chain G from PDB  Type:PROTEIN  Length:279
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:279
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276         
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVD 285
               SCOP domains d3e08g_ G: automated matches                                                                                                                                                                                                                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh....hhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhh....hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e08 G   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGWW 402
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276      |||
                                                                                                                                                                                                                                                                                                              283||
                                                                                                                                                                                                                                                                                                               403|
                                                                                                                                                                                                                                                                                                                402


Chain H from PDB  Type:PROTEIN  Length:278
 aligned with T23O_XANCP | Q8PDA8 from UniProtKB/Swiss-Prot  Length:298

    Alignment length:278
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276        
           T23O_XANCP     7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV 284
               SCOP domains d3e08h_ H: automated matches                                                                                                                                                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhh.........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhh....hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3e08 H   7 LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQSQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVWW 402
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276     |||
                                                                                                                                                                                                                                                                                                             282||
                                                                                                                                                                                                                                                                                                              403|
                                                                                                                                                                                                                                                                                                               402
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3E08)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3E08)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H   (T23O_XANCP | Q8PDA8)
molecular function
    GO:0051213    dioxygenase activity    Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004833    tryptophan 2,3-dioxygenase activity    Catalysis of the reaction: L-tryptophan + O2 = N-formyl-L-kynurenine.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0051289    protein homotetramerization    The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
    GO:0006569    tryptophan catabolic process    The chemical reactions and pathways resulting in the breakdown of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid.
    GO:0019442    tryptophan catabolic process to acetyl-CoA    The chemical reactions and pathways resulting in the breakdown of tryptophan into other compounds, including acetyl-CoA.
    GO:0019441    tryptophan catabolic process to kynurenine    The chemical reactions and pathways resulting in the breakdown of tryptophan into other compounds, including kynurenine.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:42 - Pro A:43   [ RasMol ]  
    Glu B:42 - Pro B:43   [ RasMol ]  
    Glu C:42 - Pro C:43   [ RasMol ]  
    Glu D:42 - Pro D:43   [ RasMol ]  
    Glu E:42 - Pro E:43   [ RasMol ]  
    Glu F:42 - Pro F:43   [ RasMol ]  
    Glu G:42 - Pro G:43   [ RasMol ]  
    Glu H:42 - Pro H:43   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3e08
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  T23O_XANCP | Q8PDA8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.13.11.11
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  T23O_XANCP | Q8PDA8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        T23O_XANCP | Q8PDA8: 1yw0 2nw7 2nw8 2nw9 3bk9

(-) Related Entries Specified in the PDB File

2nw7 WILD TYPE
2nw8 WILD TYPE
3bk9 H55A MUTANT