|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3CP3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3CP3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3CP3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3CP3) |
Exons (0, 0)| (no "Exon" information available for 3CP3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:127 aligned with Q6NFL3_CORDI | Q6NFL3 from UniProtKB/TrEMBL Length:145 Alignment length:131 16 26 36 46 56 66 76 86 96 106 116 126 136 Q6NFL3_CORDI 7 DPITILDSSDSLSRLSSESVGRLVVHRKDDLDIFPVNFVLDYSAEQPRVYFRTAEGTKLFSVNLNSDVLFEVDRFDDAEGWSVVLKGNAYVVRDTEEARHADTLGLKPWLPTLKYNFVRIDVREVSGRAFV 137 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 3cp3A00 A:7-137 Electron Transport, Fmn-binding Protei n; Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 3cp3 A 7 DPITILDSSDSLSRLSSESVGRLVVHRKDDLDIFPVNFVLDYSAEQPRVYFRTA--TKLFSVNLNSDVLFEVDRFD--EGWSVVLKGNAYVVRDTEEARHADTLGLKPWLPTLKYNFVRIDVREVSGRAFV 137 16 26 36 46 56 | | 66 76 | 86 96 106 116 126 136 60 63 82 85
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3CP3) |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3CP3) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q6NFL3_CORDI | Q6NFL3)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|