3CNW - JenaLib

Title :   THREE-DIMENSIONAL STRUCTURE OF THE PROTEIN XOXI (Q81AY6) FROM BACILLUS CEREUS. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET BCR196.

Authors :   A. P. Kuzin, M. Abashidze, J. Seetharaman, H. Wang, C. Ciccosanti, L. Mao, R. Xiao, R. Nair, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt, L. Tong, Northeast Structural Genomics Consortium (Nesg)

Date :   26 Mar 08 (Deposition) - 08 Apr 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.48

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A  (1x)
Biol. Unit 3: B  (1x)

Keywords :   Q81Ay6, Nesg, X-Ray, Xoxi, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. P. Kuzin, M. Abashidze, J. Seetharaman, H. Wang, C. Ciccosanti, L. Mao, R. Xiao, R. Nair, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt, L. Tong
Three-Dimensional Structure Of The Protein Xoxi (Q81Ay6) From Bacillus Cereus. Northeast Structural Genomics Consortium Target Bcr196.
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 7)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:142
 aligned with Q81AY6_BACCR | Q81AY6 from UniProtKB/TrEMBL  Length:140

    Alignment length:142
                                                                                                                                                                   140    
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       | -  
         Q81AY6_BACCR     3 MAHTTTSMEIFGSPEQVWQLIGGFNSLPDWLPYIPSSKLTEGGRVRHLANPDGDTIIERLEVFNDKERYYTYSIMNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFTPVEVSDEEAINLFHGIYSDGLKALQQAFLD----   -
               SCOP domains d3cnwa1 A:3-140 Uncharacterized protein XoxI                                                                                              ---- SCOP domains
               CATH domains -3cnwA00 A:4-144  [code=3.30.530.20, no name defined]                                                                                          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee..hhhhhhhhhh...hhhhh.....eeeeehhh.eeeee.....eeeeeeeeee....eeeeeeee....eeeeeeeeeeee......eeeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cnw A   3 mAHTTTSmEIFGSPEQVWQLIGGFNSLPDWLPYIPSSKLTEGGRVRHLANPDGDTIIERLEVFNDKERYYTYSImNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFTPVEVSDEEAINLFHGIYSDGLKALQQAFLDLEHH 144
                            |      |12        22        32        42        52        62        72    |   82        92       102       112       122       132       142  
                            |     10-MSE                                                             77-MSE                                                               
                            3-MSE

Chain B from PDB  Type:PROTEIN  Length:141
 aligned with Q81AY6_BACCR | Q81AY6 from UniProtKB/TrEMBL  Length:140

    Alignment length:141
                                                                                                                                                                     140 
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140 
         Q81AY6_BACCR     1 MNMAHTTTSMEIFGSPEQVWQLIGGFNSLPDWLPYIPSSKLTEGGRVRHLANPDGDTIIERLEVFNDKERYYTYSIMNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFTPVEVSDEEAINLFHGIYSDGLKALQQAFLD-   -
               SCOP domains d3cnwb_ B: Uncharacterized protein XoxI                                                                                                       SCOP domains
               CATH domains -3cnwB00 B:2-141  [code=3.30.530.20, no name defined]                                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeee..hhhhhhhhhh...hhhhhh.....eeeehhh.eeee.......eeeeeeeee....eeeeeeee....eeeeeeeeeeee......eeeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cnw B   1 mNmAHTTTSmEIFGSPEQVWQLIGGFNSLPDWLPYIPSSKLTEGGRVRHLANPDGDTIIERLEVFNDKERYYTYSImNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFTPVEVSDEEAINLFHGIYSDGLKALQQAFLDL 141
                            | |     10        20        30        40        50        60        70      | 80        90       100       110       120       130       140 
                            1-MSE   10-MSE                                                             77-MSE                                                            
                              3-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (Q81AY6_BACCR | Q81AY6)

molecular function
	GO:0010427	abscisic acid binding	Interacting selectively and non-covalently with abscisic acid, plant hormones that regulate aspects of plant growth.
	GO:0004864	protein phosphatase inhibitor activity	Stops, prevents or reduces the activity of a protein phosphatase, an enzyme that hydrolyzes phosphate groups from phosphorylated proteins.
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
biological process
	GO:0009738	abscisic acid-activated signaling pathway	A series of molecular signals generated by the binding of the plant hormone abscisic acid (ABA) to a receptor, and ending with modulation of a cellular process, e.g. transcription.
	GO:0043086	negative regulation of catalytic activity	Any process that stops or reduces the activity of an enzyme.
	GO:0080163	regulation of protein serine/threonine phosphatase activity	Any process that modulates the frequency, rate or extent of protein serine/threonine phosphatase activity: catalysis of the reaction: protein serine/threonine phosphate + H2O = protein serine/threonine + phosphate.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 3cnw)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3cnw)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3cnw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q81AY6_BACCR \| Q81AY6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description