Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  COBR
 
Authors :  A. D. Lawrence, M. J. Warren, R. W. Pickersgill
Date :  21 Feb 08  (Deposition) - 11 Mar 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Corrin Reductase, Cobr, Six-Stranded Anti-Parallel Beta- Barrel, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. D. Lawrence, E. Deery, K. J. Mclean, A. W. Munro, R. W. Pickersgill, S. E. Rigby, M. J. Warren
Identification, Characterization, And Structure/Function Analysis Of A Corrin Reductase Involved In Adenosylcobalamin Biosynthesis
J. Biol. Chem. V. 283 10813 2008
PubMed-ID: 18263579  |  Reference-DOI: 10.1074/JBC.M710431200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 4-HYDROXYPHENYLACETATE 3-MONOOXYGENASE
    Chains: A, B, C, D
    EC Number: 1.14.13.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET14B
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: COBR
    Organism Scientific: BRUCELLA MELITENSIS
    Organism Taxid: 29459
    Synonym: COBR, CORRIN REDUCTASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:44 , THR A:45 , LEU A:46 , THR A:47 , ALA A:48 , CYS A:62 , LEU A:63 , GLN A:64 , HIS A:67 , PHE A:95 , SER A:96 , GLY A:97 , ARG A:106 , TYR A:163 , TYR A:168BINDING SITE FOR RESIDUE FMN A 200
2AC2SOFTWARELEU B:44 , THR B:45 , LEU B:46 , THR B:47 , ALA B:48 , CYS B:62 , LEU B:63 , GLN B:64 , HIS B:67 , PHE B:95 , SER B:96 , ARG B:106 , TYR B:163 , TYR B:168BINDING SITE FOR RESIDUE FMN B 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CB0)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Asn A:55 -Pro A:56
2Asn B:55 -Pro B:56
3Asn C:55 -Pro C:56
4Asn D:55 -Pro D:56

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3CB0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3CB0)

(-) Exons   (0, 0)

(no "Exon" information available for 3CB0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:166
 aligned with Q8YHT7_BRUME | Q8YHT7 from UniProtKB/TrEMBL  Length:173

    Alignment length:166
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167      
         Q8YHT7_BRUME     8 ISSVSTVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
               SCOP domains d3cb0a_ A: automated matches                                                                                                                                           SCOP domains
               CATH domains 3cb0A00 A:8-173 Electron Transport, Fmn-binding Protein; Chain A                                                                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhh...ee.eeeee......eeeee..eeeee....eeeeeee..hhhhhhhhhhheeeeee.hhhhhhhhhhhh.....hhhhhhh...ee.......ee....eeeeeeeeeeeee..eeeeeeeeeeeee....eeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cb0 A   8 ISSVSTVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167      


Chain B from PDB  Type:PROTEIN  Length:163
 aligned with Q8YHT7_BRUME | Q8YHT7 from UniProtKB/TrEMBL  Length:173

    Alignment length:163
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170   
         Q8YHT7_BRUME    11 VSTVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
               SCOP domains d3cb0b_ B: automated matches                                                                                                                                        SCOP domains
               CATH domains 3cb0B00 B:11-173 Electron Transport, Fmn-binding Protein; Chain A                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh...ee.eeeee......eeeee..eeeee....eeeeeee..hhhhhhhhhhheeeeee.hhhhhhhhhhhh.....hhhhhhh...ee.......ee....eeeeeeeeeeeee..eeeeeeeeeeeee....eeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cb0 B  11 VSTVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170   


Chain C from PDB  Type:PROTEIN  Length:162
 aligned with Q8YHT7_BRUME | Q8YHT7 from UniProtKB/TrEMBL  Length:173

    Alignment length:162
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  
         Q8YHT7_BRUME    12 STVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
               SCOP domains d3cb0c_ C: automated matches                                                                                                                                       SCOP domains
               CATH domains 3cb0C00 C:12-173 Electron Transport, Fmn-binding Protein; Chain A                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhh...ee.eeeee......eeeee..eeeee....eeeeeee..hhhhhhhhhhheeeeee.hhhhhhhhhhhh.....hhhhhhh...ee.......ee....eeeeeeeeeeeee..eeeeeeeeeeeee....eeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3cb0 C  12 STVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171  


Chain D from PDB  Type:PROTEIN  Length:161
 aligned with Q8YHT7_BRUME | Q8YHT7 from UniProtKB/TrEMBL  Length:173

    Alignment length:161
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172 
         Q8YHT7_BRUME    13 TVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
               SCOP domains d3cb0d_ D: automated matches                                                                                                                                      SCOP domains
               CATH domains 3cb0D00 D:13-173 Electron Transport, Fmn-binding Protein; Chain A                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh...ee.eeeee......eeeee..eeeee....eeeeeee..hhhhhhhhhhheeeeee.hhhhhhhhhhhh.....hhhhhhh...ee.......ee....eeeeeeeeeeeee..eeeeeeeeeeeee....eeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cb0 D  13 TVESKAYRDAMSHYAGAVQIVTTAGAAGRRGLTLTAACSVSDNPPTILICLQKIHEENRIFIENGVFAINTLAGPHQQLADAFSGRIGLTQDERFELAAWEILATGAPVLKGALAAFDCRVVSVQDHSTHHVLFGEVVGLSSHAEEEALIYLNRRYHKLEL 173
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CB0)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q8YHT7_BRUME | Q8YHT7)
molecular function
    GO:0052881    4-hydroxyphenylacetate 3-monooxygenase activity    Catalysis of the reaction: (4-hydroxyphenyl)acetate + FADH(2) + O(2) = 3,4-dihydroxyphenylacetate + FAD + H(+) + H(2)O.
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:55 - Pro A:56   [ RasMol ]  
    Asn B:55 - Pro B:56   [ RasMol ]  
    Asn C:55 - Pro C:56   [ RasMol ]  
    Asn D:55 - Pro D:56   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3cb0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8YHT7_BRUME | Q8YHT7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.14.13.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8YHT7_BRUME | Q8YHT7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8YHT7_BRUME | Q8YHT7: 4ira

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3CB0)