|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 8)| Asymmetric Unit (2, 8) Biological Unit 1 (2, 16) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3C3M) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3C3M) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3C3M) |
Exons (0, 0)| (no "Exon" information available for 3C3M) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:123 aligned with A3CS79_METMJ | A3CS79 from UniProtKB/TrEMBL Length:211 Alignment length:123 1 | 9 19 29 39 49 59 69 79 89 99 109 119 A3CS79_METMJ - -MYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDPATRDIPVLMLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLARR 122 SCOP domains d3c3ma_ A: automated matches SCOP domains CATH domains 3c3mA00 A:1-123 [code=3.40.50.2300, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript 3c3m A 1 SLYTILVVDDSPmIVDVFVTmLERGGYRPITAFSGEECLEALNATPPDLVLLDImmEPmDGWETLERIKTDPATRDIPVLmLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLARR 123 10 | 20| 30 40 50 || 60 70 80| 90 100 110 120 13-MSE 21-MSE 55-MSE 81-MSE 56-MSE 59-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3C3M) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (A3CS79_METMJ | A3CS79)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|